CAZyme Information: MGYG000002564_01818

Basic Information

• Species: CAG-831 sp902388455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp902388455
• CAZyme ID: MGYG000002564_01818
• CAZy Family: GT92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		36460.69	9.2146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002564	2497816	MAG	China	Asia

• Gene Location: Start: 10698; End: 11636 Strand: +

Full Sequence      

MPLSISCPRSQVSNVNPPLPMNKVLAEIIAGVIPHKMTRNRWRGILRYGIFKAIRLRHQL
RHDRTQPRYCLAVCAIAKNEGPYFKEWIEWHKSKGVEKFYIYDNDSTDGTMEILRPYIES
GIVEYTFFPGYRRQLAAYDDCLDRHRMEARWIAFIDLDEFIVPVKDRTIPEFLSRFEDCP
AVEINWLVYGSGGAKKRVPGTMMERFRCHSVPDHPLNRHVKSIVDPRRVYTMTGCHEAAR
ITGHAADSHGNPIKKNFRERPPQQDVIRINHYAVRSYEEFLEKQARGRASGTQKTVKSEY
FDQYDLNDIQDT

Enzyme Prediction     

No EC number prediction in MGYG000002564_01818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT92	77	284	3.5e-28	0.7562724014336918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01697	Glyco_transf_92	1.09e-30	83	268	19	235	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
pfam13704	Glyco_tranf_2_4	1.88e-18	78	173	1	97	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd00761	Glyco_tranf_GTA_type	0.002	77	182	5	111	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02511	Beta4Glucosyltransferase	0.003	71	286	2	178	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	0.006	73	230	2	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD39434.1	8.67e-166	21	309	1	289
QCP73126.1	8.67e-166	21	309	1	289
ADY36745.1	1.03e-152	21	311	1	290
SCD19281.1	4.36e-145	21	310	31	320
QPH38826.1	1.22e-138	23	311	37	325

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6YRM6	6.55e-15	69	283	314	517	Glycosyltransferase family 92 protein Os08g0121900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0121900 PE=2 SV=1
B9SLR1	5.01e-14	64	283	274	483	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0530710 PE=3 SV=1
Q94K98	1.76e-12	61	160	283	383	Glycosyltransferase family 92 protein At1g27200 OS=Arabidopsis thaliana OX=3702 GN=At1g27200 PE=2 SV=2
B9S2H4	3.17e-12	68	283	294	506	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0699480 PE=3 SV=1
Q9LTZ9	1.37e-09	85	243	275	447	Galactan beta-1,4-galactosyltransferase GALS2 OS=Arabidopsis thaliana OX=3702 GN=GALS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002564_01818.