CAZyme Information: MGYG000002561_01466

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_01466
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002561_8|CGC1	43188.84	5.6843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 70849; End: 71976 Strand: +

Full Sequence      

MKKIFLVLLGAAFCLAGTSCTAKQPKAEEVVGIIDKVNNYWQETHPQHGRSFWDNAAYHT
GNMEAFFLTSNPRYYDYSKAWAEHNEWKGAKSDDKQEWKYSYGESDDYVLFGDYQICFQT
YVDLYTVDPDSQKIARAREVMEYQMSTDKNDYWWWADGLYMVMPVMTKMYKLTKNPLYLE
KLHEYWTYANSIMYDDESGLYYRDAKYVYPKHKTVNGKKDFWARGDGWVLAGLAKVLKDL
PETDKYRQEYIDRFRTMAKAVVACQQPEGYWTRSMLDAEHAPGPETSGTAFFTYGLLWGM
NNGLLDKATYQPAVMKAWNYLTTVALQPDGRVGYVQPIGEKAIPGQVVDANSTANFGVGA
FLLAACEMVRFLNAD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	370	6.4e-82	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.28e-106	33	372	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.65e-42	113	370	80	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT64861.1	9.53e-264	1	375	1	375
QUU00388.1	3.88e-263	1	375	1	375
QQA30832.1	3.88e-263	1	375	1	375
QUT33910.1	3.88e-263	1	375	1	375
QUT62329.1	3.88e-263	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.36e-236	1	374	1	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.56e-181	27	373	13	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	3.41e-62	17	370	7	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	7.76e-16	19	368	7	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.34e-15	27	368	7	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	6.27e-61	6	370	5	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.25e-57	41	370	44	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	9.81e-47	153	369	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	4.25e-15	19	368	7	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000513	0.364625	0.634412	0.000144	0.000161	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_01466.