CAZyme Information: MGYG000002561_00569

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00569
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		90828.11	5.8732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 158565; End: 160955 Strand: -

Full Sequence      

MRKTLFILLLLSASKFSTYGQVRLTQDAELEKQLYESGLIHQPLPLNTGNSFEANGWKKE
VLQSDTLPLSESLKLQFPTYTGKRATGSPSDPDYATYGNSSVAYQLNGANLERYNRIVFS
IYPDCDGARVVNVNLTFVNAGTPGKQGYNQPTGSHLINLVNKEWNQCFLEIDEYQRDKVM
EIRFSTAQKGKDRTTGDSAVYYINNLQLQTVKNPEKVSGWVPAEGKIVYSTTGYALNSPK
TAIVNVDTPIYNSRRFQLLNPDGETVYEGDIKEETSTIGRFGLLDFTAFDRPGEYRLKAG
NLLTPTFRIGESIWEDSQWKVLNFIFCQRCGYPVPGKHGTCHIDLMSRHDGRSISYAGGW
HDAGDLSQQTLQTGDVTFALLEAYNKLRNKNIALAARLREEAEWGVEFILKNRYGDGYRA
SSVGLLIWQDGIFNTLDDISTVRVQNMAFDNFLYAGYEAYASMTLDNDPMLQEHLLRVAE
EDFAFAMEKYKRDGFDKFLQPYEHSYNTSESQYMATISWSASQLYKLTHKPYYAEIAAEY
IRYTLDCQRTEPLNDKDKTCGFFYRNTSKQSIIHYIHQSREQVYMQAMSLLCETQPEHPD
FPRWARSIELYGNYLKGLMKYTLPYGMIPSGVYHAEEYKDTTGFYALHLFPPTNAEELYT
EQIKQGIRLDKEHYVKRFPVWFNIFNGNTAIHLSTGKAAAICGNFLQDKELLDIGREQLY
WTVGKNPFGQSLIYGEGHNYPQLNSFSSGEITGEMPVGIRTLGNDDIPYWPQTNNACYKE
VWVTSAGKWLSLIAEY

Enzyme Prediction     

No EC number prediction in MGYG000002561_00569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	318	742	1.6e-34	0.8421052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02850	E_set_Cellulase_N	7.27e-16	226	309	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	5.68e-10	226	302	2	81	Cellulase N-terminal ig-like domain.
pfam00759	Glyco_hydro_9	7.20e-06	320	545	5	243	Glycosyl hydrolase family 9.
pfam00680	RdRP_1	3.92e-04	592	664	11	85	RNA dependent RNA polymerase.
PLN00119	PLN00119	0.006	692	742	357	408	endoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU26859.1	3.12e-22	227	796	65	604
ARW20213.1	2.53e-21	732	795	1	64
QDH79293.1	1.13e-16	206	540	6	383
AHW60805.1	8.63e-16	223	540	19	376
QEH39932.1	1.38e-15	256	458	52	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DGQ_A	1.58e-07	278	418	58	210	Crystalstructure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGQ_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGR_A Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum],5DGR_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum]
6GDT_A	2.46e-06	279	766	60	523	Crystalstructure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_B Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_C Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_D Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_E Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002165	0.993677	0.003493	0.000224	0.000216	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00569.