CAZyme Information: MGYG000002558_02333

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_02333
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		94804.57	6.7173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 2826; End: 5366 Strand: -

Full Sequence      

MTKLKTIGRTALTVLTVASMTTATAAEVEWYDGTKAVTYSVQKNTDPVVGIALQMFASDM
EAVTGRKAVAAPESSAAIRLVELDKATSAVRKKLEKSGVPVDELEGKTDGFHISVEGSQV
TIVGTNGRGTAYGLLEMSRMAGVSPWVWWGDVVPERRQRLTIDSEFETLQGASVEYRGIF
LNDEDWSLRPWSYGNYEPGKFGEIGPKTYKKVFQLLLRLRANAIWPGMHTGTVAFFKIKG
AKAMADSCGIAIGTSHCEPLLRNNVDEWDTKERGRFNYITNKDAVQQYWIERLKEVKGSA
GGNMFTIGMRGIHDGSMEGVKTMDEKFNALQQVIDDQQELLGKYIGDPEKQTQVFVPYKE
VLEIYERGLKVPDYVTLMWCDDNYGYMTRLSDEAEQRRSGGGGVYYHLSYWGRPHDYLWL
TTTQPGLIYNEMRAAYDHNVRKIWIVNVHDPKVAGYDLELFLDMAWDINSVSASTIADHY
RAWLCRQFGNEAGNKLYPAMHEFYRLCGERRPEFMGWSQTELSKATFDRGLSPVRNTQFS
TTAFGGELDRYLERYAGVAKTVGEAEALVRPELKDAYFAAIKYPVLAAEAHARKMLEAQR
ARQMANGSTTKGMFDSNPALYTAVAKSQKAYEEIRKLTEYYNERMSGGKWNRSMNMRPRD
LPVHGAPLLPTMLTDEEVDEWLAKAPVGKAHPVEADGTVTRNACDYQQATEGAQPVEMLG
HSMNAVALPKGGTLTYTFTTAKDGDAVLRTALIPTQPNDKGDIRFSVSVDGAEPTVYTLK
EKFRSEGWKQNVLRGQAVRTLKLPGLAAGPHKLEIKALDNHIVVDQWMVDYDADRKFYLF
PTTGEK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	27	827	6.9e-208	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	2.58e-164	173	514	4	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.46e-20	693	842	3	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd02795	CBM6-CBM35-CBM36_like	0.003	720	831	23	121	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39773.1	0.0	30	841	25	840
AGB28367.1	0.0	9	842	10	845
QUT71792.1	0.0	27	841	38	856
QJR70031.1	0.0	27	841	41	855
QJR74363.1	0.0	27	841	41	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	3.36e-192	47	835	38	778	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	6.53e-90	41	840	57	845	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	1.12e-83	41	840	29	829	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	1.14e-83	41	840	30	830	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.23e-76	94	846	83	935	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999019	0.000187	0.000173	0.000173	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_02333.