CAZyme Information: MGYG000002558_01723

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_01723
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000002558_39|CGC1	25241.42	5.1032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 1610; End: 2284 Strand: -

Full Sequence      

MWGKNDDWVSQGRLKDVVDRLVASGEARPMVIVTPDAGGGDPNVYQNGYFDMDGWKYETF
FFTELVPFIEKQFRTGGSKANRAIAGLSMGGGGATAYGLRHPDMFCAVYAMSALMDIPDG
RETDAEKPDGKLAKLTRSVIDHSCVQFVAEADSQSRERLRSVQWFVDCGDDDFLLDRNID
FTRAMRHAAIPCQFRVRDGVHDWEYWHTALYLCLPFVSRNFSAQ

Enzyme Prediction     

No EC number prediction in MGYG000002558_01723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	4	217	1.1e-42	0.8149779735682819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	6.88e-26	6	210	33	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.51e-22	25	224	96	315	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	5.31e-16	6	210	107	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	4.05e-10	84	207	105	220	Esterase/lipase superfamily enzyme [General function prediction only].
COG2819	YbbA	0.001	57	112	116	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM58192.1	1.49e-20	1	219	189	398
QHS51382.1	1.75e-20	8	219	153	348
VTR91196.1	3.60e-20	8	220	322	509
SCD19884.1	3.70e-20	1	220	183	391
ASB48757.1	4.89e-20	8	222	193	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	3.62e-109	1	224	53	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	5.40e-19	3	219	174	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	5.42e-16	42	217	79	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
1JJF_A	4.97e-15	3	219	73	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.30e-14	3	219	73	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	9.39e-14	3	219	92	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	6.97e-11	2	105	544	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	7.56e-10	8	220	481	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	7.92e-09	64	219	101	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P31471	5.94e-07	9	119	191	312	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_01723.