CAZyme Information: MGYG000002558_00267

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_00267
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000002558_2|CGC1	43659.36	7.9874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 59138; End: 60316 Strand: +

Full Sequence      

MALSACSNGNKGDEQVVAPWGVVNDTVASNATFDLDEIVGNGEMIMATLSGPESYYDYHG
KHLGLHFLLCQRFADKIGVSLRVEVCRDTMELMRKLIDGDADVAAYWVSPSDTAALADSS
GAVVMCGPRNNSDGARWVAKASSDMLVKAIDEWFKPSMLADVEREEDFLLSSKSVSRRVY
APMQDRQKGIISRYDALFVKHSQRIRWDWRLLAAQCYQESTFDPNAKSWAGACGLMQIMP
STAAHLGLALSDIFTPEANIEAATRYLGELESKFSDIANRNERTNFVLASYNGGYHHIRD
AMSLAAKNGSDPKSWSEVSRYVLLLSEPRYYRDPVVKHGYMRGFETVGYVSKIRQRWQQY
GGVRSPHGSASGLTPRKARHSKKKFKLNPDGQ

Enzyme Prediction     

No EC number prediction in MGYG000002558_00267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	200	359	1.9e-28	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	9.98e-78	198	360	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.48e-50	35	359	36	448	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.80e-44	34	359	15	429	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.22e-25	208	301	11	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.97e-23	194	299	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	7.56e-145	14	380	23	385
QVJ81630.1	1.55e-138	1	387	13	375
QUB48180.1	1.82e-138	3	388	16	391
ADE82116.1	4.41e-138	1	387	13	375
VEH15587.1	1.09e-134	14	374	53	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	9.94e-24	191	355	256	416	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.06e-23	191	355	263	423	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.06e-23	191	355	263	423	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	3.01e-23	191	373	249	427	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.01e-23	191	373	249	427	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	1.19e-31	35	358	40	451	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	7.88e-31	35	358	40	451	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
Q0A9W6	1.31e-29	35	375	37	475	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1
Q3YYZ7	3.02e-29	38	355	39	446	Membrane-bound lytic murein transglycosylase F OS=Shigella sonnei (strain Ss046) OX=300269 GN=mltF PE=3 SV=2
A4WDC7	4.09e-29	38	355	39	446	Membrane-bound lytic murein transglycosylase F OS=Enterobacter sp. (strain 638) OX=399742 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999098	0.000782	0.000089	0.000003	0.000002	0.000020

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_00267.