CAZyme Information: MGYG000002552_02500

Basic Information

• Species: Lachnospira sp000436535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000436535
• CAZyme ID: MGYG000002552_02500
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000002552_22|CGC1	35733.17	5.7395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002552	3071336	MAG	China	Asia

• Gene Location: Start: 19277; End: 20224 Strand: +

Full Sequence      

MITVSKDNTGDYNSIQQAIDSISPSCERETIFIKNGIYKERVEIKKDNITLIGESKEHTV
ITEGYYALMTMPDNSRRGTFRSYTFFVNANNFQAFNITFENSAGFGKKVGQAIAVYAEGD
NLTFKNCRLLGHQDTLFTGPLPLKEKQPGGFVGPTEFAPRIPYKQLYEDCYICGEIDFIF
GSATAYFKNCTLYALDRGEKINSYYTAPSTYEGQKFGYVFDGCTFTGNCPKETCYLSRPW
RIHAKVVLLNCEYSDQVIKEGFDDWNKKEAHDTVYYAEYNGHGPGYQPEKRASYAKILTD
EEALLYTKKNVLAGE

Enzyme Prediction     

No EC number prediction in MGYG000002552_02500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	313	3.3e-93	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.83e-76	1	314	83	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	9.50e-64	2	315	2	298	Pectinesterase.
PLN02773	PLN02773	3.00e-59	1	303	6	287	pectinesterase
PLN02432	PLN02432	3.36e-55	1	315	12	289	putative pectinesterase
PLN02665	PLN02665	8.94e-52	2	303	70	345	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	5.85e-170	1	312	1	311
ADZ82949.1	3.41e-114	4	314	3	314
QEH68466.1	1.38e-113	4	314	3	314
SET76962.1	5.05e-111	1	314	1	315
QOV20146.1	2.12e-109	1	315	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.45e-30	2	314	9	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.76e-30	4	314	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.18e-28	12	312	18	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	2.24e-28	11	285	43	334	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	7.22e-26	2	285	11	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.40e-41	1	303	6	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43043	3.58e-38	3	307	60	348	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q8GX86	5.39e-38	2	315	256	551	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q1PEC0	2.73e-37	2	315	216	510	Probable pectinesterase/pectinesterase inhibitor 42 OS=Arabidopsis thaliana OX=3702 GN=PME42 PE=2 SV=1
Q3E8Z8	6.40e-37	2	315	253	548	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999761	0.000276	0.000009	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002552_02500.