CAZyme Information: MGYG000002551_01408

Basic Information

• Species: Haemophilus_A paraphrohaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A paraphrohaemolyticus
• CAZyme ID: MGYG000002551_01408
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29216.97	10.0227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002551	1748237	MAG	China	Asia

• Gene Location: Start: 4539; End: 5324 Strand: -

Full Sequence      

MQTAFRASILSLGIKADKKMGFNKDRAREMQWLFTNQKVEQTTSLHVLDGQMMFAKAIGV
TDLTPKWQLPIPAETVEKAKQWLDPMRKNVVISPCSSKAEKDWLIDRYADIANWLMAQNI
NVILVGSPAKRELEMTACIQQLAPNVQNLVGKTSLKELAALLKLADLVLSPDTGSAHIAS
IQGTPVIGLYAIHNPRRTAPYNDQKNVISVYDEAVQDYYGKSWQALPWATKAKSKTGENL
MVRISVESVKQKVVEILVRNR

Enzyme Prediction     

No EC number prediction in MGYG000002551_01408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	2	211	6.6e-45	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	1.26e-43	1	210	19	229	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	1.03e-30	1	261	88	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	6.66e-27	1	255	85	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	7.03e-08	33	203	128	301	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	1.96e-04	101	208	195	305	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN11298.1	2.43e-172	1	261	87	347
QRP12492.1	2.43e-172	1	261	87	347
AWI50066.1	1.69e-137	1	257	87	343
ASU16106.1	2.30e-128	1	257	88	344
ACE60840.1	2.30e-128	1	257	88	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.21e-07	96	212	194	309	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.44e-90	1	249	91	337	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	3.82e-10	46	190	127	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999956	0.000101	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002551_01408.