CAZyme Information: MGYG000002551_01342

Basic Information

• Species: Haemophilus_A paraphrohaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A paraphrohaemolyticus
• CAZyme ID: MGYG000002551_01342
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32098.12	5.3627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002551	1748237	MAG	China	Asia

• Gene Location: Start: 59; End: 901 Strand: +

Full Sequence      

MAGAISIAEESTSFAGVTHPSENGGLGFNFKWNMGWMNDTLAYMKLDPIYRQYHHNKMTF
GMVYQYSENFVLPLSHDEVVHGKCSLLGKMPGDAWQKFANLRAYYGYMWGYPGKKLLFMG
NEFAQGREWNYEESLDWFLLDENIGGGWHKGVLKLVKDLNRIYQQNRPLFELDNSPEGFD
WLVVDDAQNSVFAFERRSTDDERIIVISNFTPVPRHDYRIGVNVAGKYEEILNTDSMYYE
GSNVGNFGTVQSEAIESHERKNSISVSIPPLATVYLKFKG

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	3	125	2.5e-66	0.4053156146179402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	3	280	451	725	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	1.38e-155	3	280	355	629	1,4-alpha-glucan branching protein GlgB.
TIGR01515	branching_enzym	2.51e-144	3	277	347	618	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0296	GlgB	9.87e-139	3	277	350	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK12568	PRK12568	4.85e-126	3	277	455	727	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH68147.1	1.27e-193	1	280	308	587
AXP40071.1	4.77e-192	1	280	450	729
BBE93385.1	4.77e-192	1	280	450	729
AKA47353.1	4.77e-192	1	280	450	729
AXP54832.1	4.77e-192	1	280	450	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	2.02e-136	1	276	334	607	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	2.34e-136	1	276	339	612	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
6JOY_A	1.12e-96	4	277	351	617	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
3K1D_A	8.44e-92	3	276	449	719	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GQW_A	4.54e-87	3	277	501	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4QK67	9.55e-193	1	280	450	729	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgB PE=3 SV=1
P45177	1.92e-192	1	279	450	728	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgB PE=3 SV=1
A5UEJ2	1.78e-190	1	280	450	729	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=glgB PE=3 SV=1
Q9CN94	4.97e-172	3	280	452	729	1,4-alpha-glucan branching enzyme GlgB OS=Pasteurella multocida (strain Pm70) OX=272843 GN=glgB PE=3 SV=1
Q0I3H7	6.16e-158	3	277	452	726	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002551_01342.