CAZyme Information: MGYG000002549_03402

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_03402
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002549_17|CGC2	42193.4	6.6032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 96214; End: 97332 Strand: -

Full Sequence      

MKLYYILAFGTLLCSQLCSSASAAMASEEPYNSGIVLRWKDCKQRIDGFGIAQAGWAKEL
FAFKNREQVMDKMFGKDGLRLNILRGEIFPHYWENETDKDFNLNDDIHIELSDSDFINKS
DDLLRRGQLWLTLKAKNKYHISKLVFSTWSAPAWMKSNGKVSNGRLKTECYTDFANYLAA
FYNAYKSKGIAPYAISPSNEPGYAAPWNSSLWTADEMGKFITSYLGPTFRKENIPAKIIF
GENPLWAVYMPQLKMVSSKDFTDTILQNYPEAKDFNLIAAGHGYSLSPDIMPIKVDKEYL
KTAILPFEMAEKADIPVWITEISDVNPLDISIHDGLKWAVTFHNYLTKANVNAIICGGEE
PCQHPIMKVSLF

Enzyme Prediction     

No EC number prediction in MGYG000002549_03402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	35	356	1.1e-150	0.7066666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	3.33e-27	43	355	44	305	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam02055	Glyco_hydro_30	9.14e-10	69	233	27	194	Glycosyl hydrolase family 30 TIM-barrel domain.
pfam14587	Glyco_hydr_30_2	1.19e-09	127	353	105	349	O-Glycosyl hydrolase family 30.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06757.1	1.63e-283	1	372	1	372
QQT78450.1	1.78e-266	1	361	1	362
QRP59665.1	1.78e-266	1	361	1	362
ASM65029.1	1.78e-266	1	361	1	362
ALK82669.1	2.34e-90	3	355	7	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WNW_A	3.76e-12	143	240	138	236	Thecrystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],2WNW_B The crystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
1NOF_A	2.35e-11	142	321	76	223	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
4FMV_A	5.88e-10	25	243	1	184	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
5NGK_A	2.26e-09	143	238	171	274	Theendo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_A The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron]
7O0E_A	4.97e-09	44	355	14	312	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G5ECR8	3.08e-14	25	234	83	297	Putative glucosylceramidase 3 OS=Caenorhabditis elegans OX=6239 GN=gba-3 PE=3 SV=1
G2Q1N4	2.89e-09	11	355	3	336	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
P17439	1.24e-07	44	247	95	310	Lysosomal acid glucosylceramidase OS=Mus musculus OX=10090 GN=Gba PE=1 SV=1
Q9UB00	2.20e-07	44	262	97	322	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2
Q4WBR2	2.04e-06	143	238	169	280	Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=neg1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000963	0.866379	0.131814	0.000305	0.000271	0.000253

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_03402.