CAZyme Information: MGYG000002542_01699

Basic Information

• Species: Lentilactobacillus parafarraginis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parafarraginis
• CAZyme ID: MGYG000002542_01699
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269		29559.2	6.9912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002542	2852137	Isolate	not provided	not provided

• Gene Location: Start: 1848; End: 2657 Strand: +

Full Sequence      

MLVTILATVGFVLLNTDSSHASVASDFINRLKAPIEKVSRQNHLYPSVMMAQAIVESDFG
QSTLSTDANNYFGIKGTYDGHSVTMETGEYSSKGKHYMTAAQFKQYPSAEASIRDNAYLL
RHGTLTDPDYYAETWTTNAVTSSDAAMALATTYATDMDYGNKLNAVIVKYDLNRLYGDTG
AATTGTAGNINQQIEQSLKKELGTSTATKVADEKRAEQTRSKITRMPETIIPRSVFEPKN
ARPTAPDEYTLQLNLPLEKIIKKGQSVQK

Enzyme Prediction     

No EC number prediction in MGYG000002542_01699.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	36	172	1.3e-28	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.48e-42	4	174	12	186	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.50e-35	4	173	294	469	amidase domain-containing protein.
PRK06347	PRK06347	2.74e-35	19	174	146	301	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	3.53e-30	26	172	10	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.31e-22	32	115	1	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB52309.1	1.99e-128	3	266	6	270
QEU38810.1	8.09e-128	3	266	6	270
QIR09716.1	8.09e-128	3	266	6	270
AFS00453.1	1.27e-99	2	263	5	259
QUX05738.1	3.63e-99	2	263	5	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.31e-34	15	174	15	181	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.27e-24	15	174	46	210	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CIT4	2.37e-31	27	189	65	227	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	6.13e-31	27	184	65	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	8.50e-31	16	184	59	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P37710	3.21e-28	25	192	181	356	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	2.17e-26	27	188	65	222	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999137	0.000139	0.000160	0.000137	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002542_01699.