CAZyme Information: MGYG000002541_01683

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_01683
• CAZy Family: GH77
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1465		166217.5	5.613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 11933; End: 16330 Strand: -

Full Sequence      

MNSEQFRLLGIETDYFAADGSFVRVSDEVLSSLAAILTAPGQHLSTSVHFDEVFTVLPEM
VALLPIGGLLPRVAAVFLLNEHGQSIPCSSIMIEGGRIELPPLPSGYYSLELHSAHQMRR
CLLIVAPHSVYQPAALRRGERLSGINVQLYSLRSQHNWGIGDFGDLRRLVADFTTDGIDF
IGINPLHALFTTHPNWASPYSPSSRRWLNPIYLDINDMRLFHISPSAQAWYNEAATQKQL
AELRAAEWVDYAQVLPFKLRALYLVFRDFCDSDDPIFAAAREAFAKFVEEQGRELRLYGT
FEALDHYFYAQNATVPFSEDSVGWLGWPEAYRYPDSAAVLAFSAAHEADIRYYMWLQWLL
ADQLDNLRHYCGEQGMILGLYGDLAVGVSRGGADTWMHRDMYCLQVSVGAPPDEFGPAGQ
NWGLPPLHPQRLKRSGYQIFINMLRANMRYYGVLRIDHVMALHRLWWIAYGNSANLGAYV
RYPLAELMAILALESRRARCVIVGEDLGIVPDEMRVALGEYGVYSYGVMYFNHNGARYLL
PEEYPEHALAVVSTHDLAPLAGYWEKNDLDTMQRLGVFTSDAQYQNLLAQRESRKGQIIA
ALHQTELLGESEDGGKLDDTITLALHRFVAMSRSRLFAIQPENLLGVTASFNIPGIANTY
PNWRYRLPEDTAAMGKNPQLHDMLRQIVATRAQPREPLPITAATTAITTTTGGIEVTSVD
KYLIDQLFSGTFADPFSYLGPHENSNGTALRVLLPGAEAVRVLDHDNPKKVLADMSLLDE
RGFFIARLEADVRRYLLQVRYGDKNTVIIEDPYRFGTTLHDYDNWLLAEGTHLRPYEQFG
SHLVEIDSVAGVSFSVWAPNARRVSVVGDFNLWDGRRHVMRFHPQSGIWDIFIPGIGEHA
LYKYEILDVNGNIRLKSDPYAFGAQLRPDTASVVTRLPERLPYDPERVTANSIDAPISIY
EVHLGSWRRNPENNFWLSYAQLADELIPYVKDMGFTHIELLPVAEFPFDGSWGYQPLGLY
APTSRFGTPQELCDFIEKAHDAGIHVLLDWVVGHFPTDEYGLNRFDGTPLYEHADPREGY
HQDWNTLIYNFGRYEVRNFLTANALYWIEHYGVDGLRVDAVASMIYRDYSRKEGEWIPNR
YGGRENLEAINFLQRTNAILQNEQRGAVSIAEESTAFTGVSHPTESGGLGFQYKWNMGWM
NDTLRYMQEDPVHRKYHHNLLTFGMIYQYSEHFVLPLSHDEVVHGKGSLLSKMPGDCWQQ
FANLRAYYGYMWGYPGKKLLFMGGEFAQGREWNYQESLDWFLLEPQYGGWHEGVQKWVRD
LNHVYQEHPALWKQDCNPEGFEWLVVDDAEQSVIAFARHGGDGKPVIIVSNFTPVPRENY
RIGVSQAGHYREILNSDSTQYNGSGVSGGEYLHTEDIPSHGRDQSLNLTLPPLGTIFLAY
EQIAEAAVQHADNSDKHGKKGNKKR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	988	1288	2e-158	0.9966777408637874
GH77	147	690	4.6e-152	0.9919028340080972
CBM48	838	923	1.1e-16	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	724	1442	6	725	1,4-alpha-glucan branching protein GlgB.
PRK14507	PRK14507	0.0	7	699	13	729	malto-oligosyltrehalose synthase.
PRK12313	PRK12313	0.0	816	1444	4	631	1,4-alpha-glucan branching protein GlgB.
PRK11052	malQ	0.0	5	694	9	692	4-alpha-glucanotransferase; Provisional
PRK12568	PRK12568	0.0	724	1442	15	730	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG76774.1	0.0	1	1445	1	1448
AEC16081.1	0.0	4	1441	21	1451
QMT45674.1	0.0	10	1442	16	1463
QKI21631.1	0.0	10	1447	13	1428
QXW91384.1	0.0	10	1447	13	1428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	5.00e-314	826	1441	1	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	3.00e-311	831	1441	1	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.86e-236	712	1438	18	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.86e-236	712	1438	18	771	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	2.62e-236	712	1438	18	771	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CDL3	0.0	720	1441	6	726	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=glgB PE=3 SV=1
Q65TI0	0.0	719	1438	5	725	1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=glgB PE=3 SV=1
Q4QK67	0.0	717	1438	3	725	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgB PE=3 SV=1
Q1R5J4	0.0	719	1441	5	726	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=glgB PE=3 SV=1
Q664I2	0.0	720	1441	6	726	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999119	0.000825	0.000032	0.000010	0.000003	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002541_01683.