CAZyme Information: MGYG000002540_03311

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_03311
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		99523.64	7.1356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 67683; End: 70280 Strand: -

Full Sequence      

MVMRKRRMLMVLLVVSGLIGSAWAIDNKGITFEQPAADCFTLIEGGKATPILLDEKDDVG
IVIAAKNLQDDFRKVTGRQAELLHSVRGPRLIVAGSLESRFIKELVKAKKIDITSLKGKR
EKYLMKAVSRPFDGVDEAWVVIGSDKRGTIYGIYELSEQIGVSPWYDWADVPVVQRKDLY
IRRGEYTAGEPAVKYRGIFLNDEAPCLTGWVKHTYGTNYGDHRFYARVFELILRLRGNFM
WPAMWAWSFYADDPENSKTAHAMGIIMGTSHHEPMARNHQEWARKRKQYGVWDYATNQKV
LDRFFREGIERVKDTEDLITIGMRGDGDAPMGGKEGADHEYVNRDEYNMNLLKKVIKNQR
RIIKDVTGKPADERPQVWAIYKEVQRFYDMGLRVPDDVIMLLCDDNWGNVRRLPNAEERK
RSGGWGMYYHVDYVGAPRNSKWLNVTPIQNMWEQLQLTYDYGVDKLWILNVGDLKPMEYP
VTLFLDMAWNPKRYTADNLLEHPRGFCARQFGEEQADEAARILNLYSKYNGRVTPEMLDR
HTYNIETGEWKQVADEYRKLEADALRQYLSLPQEYHDAYKQLILFPVQAMANLYEMYYAQ
AMNHKLYKENNPQANFWADKVVQTFKFDSLLCDDYNNVMSGGKWKNMMAQKHIGYTSWND
NFRANIMPEVFRIENPERQKGGYVFTGKYGVVSMEAEHYFEANPSASADWKVIPYLGRTL
SGVALMPYTGGVEGASLTYKMALPENVSEVNVHVVVKSTLAFHDVKGHEYTVGFDGGKET
VVNFNADLNEESENVYSVFYPTVARRVVEKTVKLTVPPSTDGMQLLTLKPLDPGIVFEKI
VVDCGGYQKSYLFMDESPCKRVLHR

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	38	840	1.6e-279	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	189	537	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.02e-40	684	856	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.008	61	156	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61499.1	0.0	5	861	2	858
EEC54467.1	0.0	12	861	9	858
QRQ48278.1	0.0	12	861	9	858
QUT46101.1	0.0	12	861	9	858
QUT85336.1	0.0	24	861	21	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	35	861	39	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	26	862	3	839	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	26	862	2	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.77e-175	51	687	25	648	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.04e-119	60	676	31	664	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998956	0.000199	0.000210	0.000159	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_03311.