CAZyme Information: MGYG000002540_02883

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_02883
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000002540_54|CGC1	50963.92	4.2622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 56257; End: 57633 Strand: +

Full Sequence      

MRRHWYEVSKLCLALCCMACFFNCSEVEIEHNEENVIYVNESSLELFCGETRQLTASPTE
STFSWVSEDPEIADVDVHGMVTAKSKGNTRIVVSSGDNKEYVEVDVEAPASKSVQAHAGK
GRVQFEVVIDNEYVQTVKVECVTDHTSMEHVVDGQSGVFKFFYEGLDEDAHNFSVTCIDR
FGNVSDPVEVSANVYGAEYQSALRNRGVAVATRFGNGLVIQWKDIPGDCVLNYKNAQGDE
VEKVVPASETNTYLYDFSSDLTYTSRALPEVGAVDTFTVGPDRLEVFEDLRAVLTSSTPC
VIHAFNFDLGGEGVGYHDDDPGNNSGNNYRAEKGDVNSPGVDLEAGGNVGYTSHGEWLMY
TVHVQDAGTYAFDLERAVNNEGRNGYYSLEIDGVSTDYVFMQDDNDWNAYKWQHETYPEN
QPQINFTEGKHTVKFVLGKDGDHGKVNFRNLRFTFVGE

Enzyme Prediction     

No EC number prediction in MGYG000002540_02883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	305	454	8e-20	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	4.98e-23	299	454	2	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam16389	DUF4998	1.29e-20	113	277	25	199	Domain of unknown function. This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.
pfam03422	CBM_6	3.51e-07	331	454	2	124	Carbohydrate binding module (family 6).
pfam02368	Big_2	1.19e-05	49	104	15	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
smart00635	BID_2	4.28e-04	39	98	7	74	Bacterial Ig-like domain 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73247.1	7.49e-180	1	455	1	452
BCA52472.1	6.09e-179	1	455	1	452
AXT53263.1	4.60e-16	248	457	371	582
AJQ97839.1	3.83e-15	297	451	140	281
QHS62593.1	2.38e-14	179	451	247	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8K_A	2.41e-07	302	393	343	443	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5LA0_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20],5LA1_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20]
5LA2_A	2.41e-07	302	393	343	443	ChainA, Carbohydrate binding family 6 [Acetivibrio thermocellus],5LA2_B Chain B, Carbohydrate binding family 6 [Acetivibrio thermocellus]
5G56_A	3.11e-07	302	393	341	441	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001744	0.238237	0.759535	0.000170	0.000159	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_02883.