CAZyme Information: MGYG000002530_02633

Basic Information

• Species: Ruminiclostridium_E siraeum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E siraeum
• CAZyme ID: MGYG000002530_02633
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		47120.75	4.4056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002530	2864211	Isolate	not provided	not provided

• Gene Location: Start: 2925759; End: 2927009 Strand: -

Full Sequence      

MKKRLTAILTVMALMLTGCAGNVTSGTESQPASDAQSGISDNESSDTSSRYEIITATEMA
EKMGLGISLGNTMEAYEATDCEKITYEWIPVVGGNEPQDYETCWGADVTTQEIIDGMKAE
GFNTVRIPVFWGNMMENDGTYTINKEYLKRVKEIVDYCEKAGVYSVINIHHFDEFIIRRN
DLDKCKEIFTHLWTQIAEYFADYPYTLVFEGYNEYLGGNQFDSSGNLKEQSETNAYKMTN
TLNQAFVDAVRGTGRYNAQRVLIVSGYWTNIDKTTSSRFQMPEDMVNDRLMVSVHYVDNS
MYWSNKIGGEEWLKYIDSQCAELKKAFLDNDIPVFMGETTSTYTASNMAKDATHTDSSEC
LSIVLGKLTELGIVPVIWDTDSHFYSRTTYKIVNESDRKVIREYSDKLKANLEAQQ

Enzyme Prediction     

No EC number prediction in MGYG000002530_02633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	100	380	1.1e-81	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.12e-47	100	379	15	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.28e-13	100	347	66	329	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK97722.1	7.61e-309	1	416	1	416
CBL35246.1	1.65e-303	1	416	1	416
AEY66181.1	2.67e-72	48	406	32	382
CCO05195.1	5.67e-62	2	403	3	395
AWI66941.1	2.17e-56	54	387	19	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XRK_A	9.67e-50	55	398	23	364	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
4W85_A	3.91e-44	58	406	7	329	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]
6WQY_A	8.09e-43	55	401	23	368	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
5D9N_A	1.09e-42	55	338	12	280	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
4W86_A	1.10e-42	58	406	7	329	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium],4W86_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	1.62e-39	54	401	23	351	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23660	1.55e-37	54	386	25	334	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P20847	2.11e-37	55	342	38	325	Endoglucanase 1 OS=Butyrivibrio fibrisolvens OX=831 GN=end1 PE=3 SV=1
P54937	3.59e-36	55	396	38	361	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P17901	3.92e-36	65	382	56	369	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002530_02633.