CAZyme Information: MGYG000002527_04131

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_04131
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
163		17560.37	9.5699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 14887; End: 15378 Strand: -

Full Sequence      

MSKVRIAVAALTLSAAGFVGLLNREGFEPTAYPDPVHGTKLPTIGFGSTEGVKMGDTITP
VAAVNRSLREVRVFENALQACIKVPLHQYEFDAYVELSHNIGPGAFCRSAIVKRLNAGDY
PGACEVILLFKRAGKQDCSARGNRVCPGLWKDRLRLNAKCKGG

Enzyme Prediction     

No EC number prediction in MGYG000002527_04131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	14	151	7.5e-34	0.948905109489051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	2.43e-59	12	160	1	139	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	3.33e-32	25	153	9	128	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16900	endolysin_R21-like	3.38e-32	9	149	2	130	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	8.97e-26	9	153	3	140	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam00959	Phage_lysozyme	9.61e-09	42	137	2	99	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP90228.1	1.05e-118	1	163	1	163
AVP94644.1	2.28e-113	1	162	1	162
QLL88418.1	3.79e-112	1	162	1	162
AUZ81315.1	3.79e-112	1	162	1	162
QJT31068.1	3.79e-112	1	163	1	163

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	2.49e-18	5	134	44	175	ChainA, Lysozyme [Acinetobacter baumannii]
2ANV_A	9.87e-17	11	135	2	128	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
7M5I_A	3.74e-16	11	158	7	150	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P09963	5.40e-16	11	135	2	128	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1
Q7Y2C0	4.32e-14	15	132	11	124	SAR-endolysin OS=Pseudomonas phage phiKMV OX=204270 GN=45 PE=1 SV=1
Q9T1T5	3.43e-13	13	153	3	136	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
P68920	2.54e-08	6	148	9	159	SAR-endolysin OS=Escherichia phage 933W OX=10730 GN=R PE=3 SV=1
P68921	2.54e-08	6	148	9	159	SAR-endolysin OS=Enterobacteria phage VT2-Sa OX=97081 GN=R PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.828930	0.162518	0.008105	0.000148	0.000118	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_04131.