CAZyme Information: MGYG000002525_03143

Basic Information

• Species: Yersinia intermedia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia intermedia
• CAZyme ID: MGYG000002525_03143
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000002525_12|CGC3	33828.22	6.4931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002525	5023222	Isolate	Finland	Europe

• Gene Location: Start: 60964; End: 61905 Strand: -

Full Sequence      

MSDLMAMSGAAYDAQSLNTLKRDAARDPQGNLRQVAQQVEGMFVQMMLKSMRSALPQDGV
MNSDQTRLYTSMYDQQVAQQMSAKGLGLADMMVEQLSGSTSPSETAGTVPMMLDNEVLQT
LPAQALAQMVRRAMPTPPTNNSAPLPQGTGNFVARMSIPAQIASQQSGIPHQLIVAQAAL
ESGWGQREIPTADGKTSYNVFGIKAGSNWDGPVSEITTTEYEQGVAKKTKARFRVYGSYV
EAVTDYVKLLTQNPRYANVAAARSPEQGAHALQQAGYATDPQYAQKLVSVIQQMKNTGEQ
AVKAYSSDLSQLF

Enzyme Prediction     

No EC number prediction in MGYG000002525_03143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	161	295	3e-35	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	0.0	1	309	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	2.98e-116	10	295	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	2.58e-95	11	294	17	342	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	1.03e-87	11	294	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	7.47e-79	10	301	15	333	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJJ20185.1	2.26e-217	1	313	1	313
VDZ55986.1	2.26e-217	1	313	1	313
ARB86774.2	2.26e-217	1	313	1	313
AVL35287.1	2.26e-217	1	313	1	313
QGR71051.1	2.26e-217	1	313	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	4.37e-70	151	313	5	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.29e-65	151	295	5	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.05e-37	163	291	15	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.36e-37	163	291	16	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.06e-36	163	291	16	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	1.86e-127	7	313	8	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	4.60e-120	1	313	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	1.31e-119	1	313	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9I4P4	8.44e-50	8	295	15	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	3.90e-40	9	296	9	307	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002525_03143.