CAZyme Information: MGYG000002525_02398

Basic Information

• Species: Yersinia intermedia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia intermedia
• CAZyme ID: MGYG000002525_02398
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		24538.49	6.2205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002525	5023222	Isolate	Finland	Europe

• Gene Location: Start: 183183; End: 183833 Strand: -

Full Sequence      

MSNNKLQLRHGRVTAPQTRGLVATDLGLIAEWENNEMEGGKNFPDLTGGSFPPPYEMDSW
SNPPPPDGLILSGGHRGNREVVNFTDKEMQHKLRSIGHPNDNFTWPTIMVNPGSDLDIYW
AYTVAHVTRGYRWFITKDDWNPAERITRAQLEATPFYEDIYPYVPYYSNNDKLVAKIEHN
VHLPKGKKGHHVIILAWIVADSGNAFYQACDVDFGQ

Enzyme Prediction     

No EC number prediction in MGYG000002525_02398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	10	213	5.3e-34	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21177	LPMO_AA10	4.50e-38	10	213	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	2.37e-27	10	212	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PRK13211	PRK13211	1.33e-23	10	215	24	194	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	4.44e-22	10	215	30	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVL34568.1	1.47e-169	1	216	1	216
ARB84783.1	1.47e-169	1	216	1	216
VDZ53969.1	1.47e-169	1	216	1	216
AJJ21099.1	1.47e-169	1	216	1	216
QGR66642.1	2.46e-152	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UAM_A	2.97e-32	3	214	14	215	Crystalstructure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b],3UAM_B Crystal structure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b],3UAM_C Crystal structure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b],3UAM_D Crystal structure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b],3UAM_E Crystal structure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b],3UAM_F Crystal structure of a chitin binding domain from Burkholderia pseudomallei [Burkholderia pseudomallei 1710b]
5FTZ_A	1.69e-26	10	214	1	172	AA10lytic polysaccharide monooxygenase (LPMO) from Streptomyces lividans [Streptomyces lividans 1326]
5WSZ_A	1.91e-19	10	213	1	165	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2BEM_A	1.47e-18	10	216	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
6T5Z_A	6.16e-18	10	211	1	168	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6LKG5	5.77e-15	24	214	55	202	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q8EHY2	1.05e-14	10	216	28	197	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q5E183	2.24e-13	25	214	55	204	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
B5ESR7	2.24e-13	25	214	55	204	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q8GBD4	6.32e-12	1	214	13	192	GlcNAc-binding protein A OS=Yersinia enterocolitica OX=630 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002525_02398.