CAZyme Information: MGYG000002525_00499

Basic Information

• Species: Yersinia intermedia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia intermedia
• CAZyme ID: MGYG000002525_00499
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000002525_2|CGC1	46588.51	7.2641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002525	5023222	Isolate	Finland	Europe

• Gene Location: Start: 23181; End: 24428 Strand: +

Full Sequence      

MDIKELPCSKHLDSIIPPLSLPMMAHPMMNTSNKTESPAGQPSAPVAATQQRAFNLPDTL
REKSNVQRILVIKLRHFGDVLLTTPLLSTLKANYPQAKIDVLLYGGTQDMLRENKTVNHA
FIVDRGLKHAGLKTQISGEKALFNALKEHHYDLILNLSDQWRAAAYCRLLKPGFSIGFHY
PKRDTWLWRYCHSTLVDIPNAAKRHTVLNNLDILAPLQLTDIITDVTMSYGAHDVERVKQ
LCQQRHINDYILIQPSARWKFKTWASESFSQLVNHLTDQGETILLTGGKDQAELDYIAEI
IAGCTQPEKVVNLSGLLALPELAVFIDNAKLFIGVDSVAMHMAAALQTPAVVLFGPSNLN
QWHPWQAPHTLLWAGHYRSLPHPNEIDTDTTDRYLNAIPVSEVINAVDSWRTQSQ

Enzyme Prediction     

No EC number prediction in MGYG000002525_00499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	141	375	4.6e-49	0.8977777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02201	heptsyl_trn_III	1.44e-114	68	408	1	340	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	9.95e-87	66	415	5	347	lipopolysaccharide core biosynthesis protein; Provisional
COG0859	RfaF	3.43e-70	66	415	1	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.16e-59	68	408	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.38e-39	141	374	3	229	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDZ59627.1	6.03e-310	1	415	1	415
AJJ17604.1	9.97e-291	28	415	1	388
ARB83709.1	9.97e-291	28	415	1	388
AVL37492.1	9.97e-291	28	415	1	388
QGR67781.1	9.55e-289	28	415	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	7.80e-13	68	358	2	291	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	1.89e-12	67	415	9	349	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	9.89e-10	68	358	2	283	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	9.89e-10	68	358	2	283	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.03e-09	68	358	2	283	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	8.69e-71	74	408	1	328	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.70e-69	74	408	1	328	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P37692	1.59e-14	68	358	2	291	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	1.69e-13	68	358	2	291	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P26469	6.68e-10	68	358	2	283	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002525_00499.