CAZyme Information: MGYG000002521_00206

Basic Information

• Species: Phytobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter ursingii
• CAZyme ID: MGYG000002521_00206
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		19937.83	9.3888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002521	6166452	Isolate	United States	North America

• Gene Location: Start: 51816; End: 52361 Strand: +

Full Sequence      

MKWLAIAGFAAVFSAQAAPELCFDEAGRDYGIDPTLLMAISIQESRLNPTAINSASAGGT
EDVCAMQLNSNNFGKLKNFNITRKDLLNNPCICVYSGAWILARNFQAYGRNWDSVGMYNT
GPNPKLIKARREYARIIKSIYTVLLARKQLLEKGTGDPVKTSPFSENADQRTPVKDEKKP
G

Enzyme Prediction     

No EC number prediction in MGYG000002521_00206.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	1.58e-44	30	142	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	1.32e-27	14	144	13	142	type III secretion system invasion protein IagB.
PRK13722	PRK13722	5.18e-23	22	148	22	149	lytic transglycosylase; Provisional
pfam01464	SLT	5.33e-20	23	138	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.19e-10	23	141	143	266	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUV05087.1	7.44e-130	1	181	1	181
AKL10122.1	7.44e-130	1	181	1	181
AUU93304.1	7.44e-130	1	181	1	181
BBE80773.1	6.12e-129	1	181	1	181
ADU73041.1	2.64e-74	1	175	1	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.00e-12	22	106	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	2.88e-21	12	144	11	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.88e-21	12	144	11	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P14499	3.59e-21	22	148	22	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P17738	3.59e-21	22	148	22	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	3.59e-21	22	148	22	149	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.999083	0.000159	0.000168	0.000159	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002521_00206.