CAZyme Information: MGYG000002518_01921

Basic Information

• Species: Serratia surfactantfaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia surfactantfaciens
• CAZyme ID: MGYG000002518_01921
• CAZy Family: GT99
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1194	MGYG000002518_11|CGC20	135678.5	5.4641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002518	5076569	Isolate	India	Asia

• Gene Location: Start: 1828511; End: 1832095 Strand: -

Full Sequence      

MISVFLPAYPFRGVKAPYLWFFYRVLSSMKEPVYFMMGNDYLCSLEQWESEKRWELEDDS
QKRLGFQLPDLNLLSDKHKVSVIDESFFSHYMEKCFNNPDALFKKFITEVIPELEAALFA
ALSQESHIECVLTWCNCPSLNAAAKRRNIKVVNLELGPLRSPEYLSTAYFDFSGVNGNTE
AERRYLSSDYRFNMNAQVAQLREFFADSPPAMPNVLQDDEDRAEDKFDVGIALQVENDSN
IIAFSNSFNNQSLLDYAEFTFPGRRLVRSHPASRFTLQAGHDAIDHSANSIGFIHRCKHI
LTINSSVGLEAMLLDVPVTVLGDCSYAFCNVANQTEKVKRLAFYLFSYLVPFELLFDINY
IRFRLSSPDEAEIITKHVNYYITRGDGMRDAEMEKKASSIIEDGSVERTVCTLMNTIEDL
NSALAAKQAEIGVLEEKVGELEATVSEQSEEIIVDVVVPVYGGLEETQECIESALATLPH
WAQLVVINDASPEPELTQWLRERAETARFKLLENEQNLGFVATVNRGMKLNPKRDVLLLN
SDVEVANDWLERIREAAYSRSRVGSITPFSNNATICSFPNFCEDNELFMGMNVQQLDDQF
STYGRENNLVEVPTGVGFCMYIRRDCLNEVGYFDVETFGRGYGEENDWCQRAAKAGWPNF
HQLNVFVYHKGGVSFAGEQNPRKTRALELLNELHPNYTKDVMDFIAHDPAKKARQQMLLR
ILAKKDVSKVLLVSHKMGGGVTQHLHELVKFYKDKAHFLLLTPEEEGRSVALSLNTNEAV
YREKFIIDVAHGYDTLVNLLRFIGVGHIHFHHMIGVADKIGELKNSLSCTYDITIHDYYF
VNANPTLTDKNGIFAGDVIPIRDKLCSEHYPIPGGMSAEQWRAKLLPWLENAERVIFPSA
DTQVRFMRDFPGCAQKSVIAWHPDYEVAAPYPEVKSTYQAGQKLKVLVLGAISREKGALM
LDEVANDLKHEDIEFHLLGYAFRPLCDAVKGHGAYSSRDLQQKLDEIKPDVIWYPAQWPE
TYSYTLSIALEYGIPVVVPNIGAFGERVVGRRDSRVIAWDTSAKKMCELWRSLRTDPQAF
FAAADAPAVLDLSHAERVEDFYRDGYLQTDWLRESELGRIDYKALLASVYASAYVEVVAV
TPAAPQGRKEKLLAILWRLSKHPALAWGVKLVPYRLQRYVKRILSRRAIHEIIG

Enzyme Prediction     

No EC number prediction in MGYG000002518_01921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT99	3	382	1.1e-154	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	6.62e-28	456	674	7	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd03823	GT4_ExpE7-like	2.79e-27	729	1060	1	312	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd04186	GT_2_like_c	6.04e-25	456	671	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd16438	beta_Kdo_transferase_KpsS_like	2.19e-15	142	327	16	205	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
cd00761	Glyco_tranf_GTA_type	2.36e-12	456	571	1	116	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKO38429.1	0.0	1	1194	1	1194
QHC44363.1	0.0	1	1194	1	1194
ASL92057.1	0.0	1	1194	1	1191
AAC00183.1	0.0	1	1194	1	1191
QLJ26159.1	0.0	1	1194	1	1191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FA1_A	2.02e-92	2	407	3	404	ChainA, Putative N-acetyl glucosaminyl transferase [Raoultella terrigena],5FA1_B Chain B, Putative N-acetyl glucosaminyl transferase [Raoultella terrigena]
5FA0_A	7.39e-92	2	407	3	404	ChainA, Putative N-acetyl glucosaminyl transferase [Raoultella terrigena],5FA0_B Chain B, Putative N-acetyl glucosaminyl transferase [Raoultella terrigena]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997327	0.002606	0.000094	0.000006	0.000003	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002518_01921.