CAZyme Information: MGYG000002517_02908

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_02908
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002517_1|CGC43	36156.32	4.8301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 3176529; End: 3177527 Strand: +

Full Sequence      

MYTMTVAPGADVSGGFYSLKAAFAAMPEDPAVPVTIRVMPGIYHEKLSLTRPNVTIEGAG
ASPSDTVISFGDYGYEIMSDGIKRGTFRSYTFFVHAADVTLRNLTIENTAGDSKTHGQAI
ALYAECDRFVAEYCRILGHQDTLFTGPLPPEEYEPGGFRGPTESAPRINGRQYYHNCYIC
GDIDFIFGSATAYFEGCTIASLGPGYVTAASTPEGQEYGYVFHDCRFAAEGCPQHAAYIG
RPWRDYARVVLMDCAIGAHIHPAGFHDWGKEHAHGTVLFAEYHSYPQDADCGCADSCRPF
AQRADFVDTLDGAQAAHFSRELVLAGDDGWLP

Enzyme Prediction     

No EC number prediction in MGYG000002517_02908.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	290	1.8e-80	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.83e-74	2	285	81	375	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.00e-56	5	282	3	259	Pectinesterase.
PLN02432	PLN02432	5.83e-48	14	331	21	292	putative pectinesterase
PLN02773	PLN02773	2.07e-47	4	282	7	263	pectinesterase
PLN02745	PLN02745	2.37e-43	5	282	288	544	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98064.1	2.05e-259	1	332	1	332
CBL11054.1	1.08e-135	16	332	14	365
VCV23720.1	4.37e-135	16	332	14	365
CBL08524.1	4.37e-135	16	332	14	365
SET76962.1	8.70e-104	13	332	9	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.46e-33	6	298	9	278	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	7.54e-29	11	282	10	262	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.18e-22	2	332	4	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.07e-21	16	243	44	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
4PMH_A	2.80e-21	12	243	44	292	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	8.80e-38	3	318	4	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LUL8	4.46e-34	3	332	658	959	Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana OX=3702 GN=PME26 PE=2 SV=1
Q9FM79	2.49e-33	14	292	90	349	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P83948	5.60e-33	3	331	271	573	Pectinesterase 3 OS=Citrus sinensis OX=2711 PE=1 SV=1
O04886	1.05e-32	10	331	278	573	Pectinesterase 1 OS=Citrus sinensis OX=2711 GN=PECS-1.1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000024	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_02908.