CAZyme Information: MGYG000002516_02310

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_02310
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002516_2|CGC6	62653.15	9.0345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 499300; End: 500946 Strand: +

Full Sequence      

MSVNFVERYKWFLLFIFILLTYFIPLETRLLWQPDEIRYAEISREMLASGNWSVPYLLDI
RYFEKPVLGYWLNSVAQWLFGSGHFSVRFVVVTSTLLTGLFVYRVALLVWHNQALAFNAL
VVFLSSFLVLSIGTYNILDPIVTMFVTVAMYYFLSGLLATDKKSKIYTSVLVGIFCGLGF
LTKGFIAVVLPALVFVVTAISLSRFKEVLCYAPIAFMAMLFIAAPWVISVALQAPDYWHY
FFWIEHVQRFIAKGSARSQPIWFYLPIVILGILPWLGFLFGALKSALFLKKGTLYFSFWL
FLFFTFFSASSGKLLTYMLPCFVPLSILIASYMEELKSKSNEKIHTLNAIINTVFGVIGV
SIIIYSLYSSRFTLYEADEQYKALLAIGGFLVWSMMGIISFFKSTRLLTLFCSIGLSLVI
GYAIPHKIESKNTPEKVINDYYSELVDKPYILTDEVGIGTSLAWGLKRTDIRLTETKGEL
AYGLAYPDVQNKYYDIKQLVNLIEENNYQGIAIVLVRPERKEILSVISQLKVKPTVEKQD
DLTFVFFN

Enzyme Prediction     

No EC number prediction in MGYG000002516_02310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	507	3.3e-117	0.9407407407407408

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	7	548	4	551	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.13e-50	10	502	8	516	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	9.22e-19	12	241	6	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.12e-09	65	228	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	1.24e-04	12	263	30	285	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY79702.1	0.0	1	548	1	548
VTP83636.1	0.0	1	548	1	548
QIF93167.1	0.0	1	548	1	548
QPN89783.1	0.0	1	548	1	548
QQP24706.1	0.0	1	548	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.79e-31	11	340	33	371	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4EUL1	3.55e-285	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	3.41e-139	12	515	12	520	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
C5BDQ8	2.70e-132	11	523	7	527	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4ETL9	1.11e-131	13	523	13	529	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
B2VBI7	4.43e-131	16	510	12	513	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
86	108
115	137
141	158
165	182
186	203
208	230
261	283
292	309
314	333
346	368
383	402
407	424