CAZyme Information: MGYG000002513_00849

Basic Information

• Species: Morganella morganii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_A
• CAZyme ID: MGYG000002513_00849
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000002513_61|CGC1	39794.84	4.4658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002513	3981937	Isolate	United States	North America

• Gene Location: Start: 17674; End: 18732 Strand: +

Full Sequence      

MTVWITTADCPAVCYNQNSGLIANRDMSFFASQDGVSPLYYTFDNTDNTSDVITREKINT
LCAPVSAGDIVIVQYPTWVNRDFEHLFITELLEMPGVKVALVLWDVLIWLWDDRDRDFTH
DEEFLLMNRCDLIFSPNEKMSARLREDGGVTTPIISLGLWDYQIEGTINPDKEYRREVTF
IGNLRKTDFSSYDGKTIITLIGDPEGLTETEKAKENLNAVGSYDNNLLPGILNGGFGLMS
YQNKNNVAEKRFFNGAERYGHYNNPLKLSLYLAAGIPVIVDSHSPHAERIKSDNLGLIID
DINDIDELLDNLTEQDYSEMVKNVGHYAAKLRTGFFTKTALAKGIKYLTDTH

Enzyme Prediction     

No EC number prediction in MGYG000002513_00849.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	17	343	1.5e-78	0.9658385093167702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	8.70e-69	1	348	1	333	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXO72322.1	1.84e-263	1	352	1	352
QXO76206.1	3.06e-262	1	352	1	352
QXO42204.1	3.06e-262	1	352	1	352
QXO68550.1	3.06e-262	1	352	1	352
QXO49506.1	3.06e-262	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	5.62e-29	45	345	46	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	2.81e-28	45	345	46	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	3.17e-28	45	345	54	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR93	1.72e-33	21	348	18	333	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	3.19e-29	17	345	14	329	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0M3KKZ0	2.97e-28	45	345	44	324	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
B5A7L9	1.49e-27	45	345	44	324	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
F8KEJ1	1.55e-24	17	345	19	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999188	0.000811	0.000035	0.000002	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002513_00849.