CAZyme Information: MGYG000002513_00489

Basic Information

• Species: Morganella morganii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_A
• CAZyme ID: MGYG000002513_00489
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	MGYG000002513_32|CGC1	70087.9	6.6418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002513	3981937	Isolate	United States	North America

• Gene Location: Start: 878; End: 2764 Strand: -

Full Sequence      

MKKSILLFISLLHFQLAAAPLTPQELEKLRYNPEQSAEYIVAGMSQTEKIGQLMILDFRY
WDIFRSPVPVPVININNDIKNIIFHYRLGGVVLFRENLIDTHQTVQLINDIQSSRYKLPL
FISTDQEGGYITRLRVGTEMPGNMALGAARDPELAKLTGDIHGSELSALGFNMNFGPVAD
INNNQNNPVIGVRAYSDRKELTEILSAAYIRGIHQHRIITALKHFPGHGNVSADSHVALP
VVTSDEKSWRQTELPPFTYALQHGADAVMTAHIIVPALDDTKIITRDGSEAGTPATLSKP
ILTGILRDELHFQGLIITDAMDMKAITDNFNLNFAVERALTAGADIILMPVKMWDEDAVK
RLDSLYRYLDEQAQKNPELQQRIDESARRVVLMKLNKAISGSAADPLIAQHIVASEQHKN
QENYVSEQAVTVIKNDGILPYHLKQNNRILVISDEHPRNQLIKKHLDDIARETETHIHVS
TQKIKTDKKRLSEKKINSMISGQDLILLVTYNLKNRNTDAQFIIDSADSAGISVIVISAR
DPYDIAYLSNVKANIAIYGITGFDITNGQRNALETNIRSGLRTLFSGKNSEPLNSPAGRL
PVDIKDPESGIVLYPYGTGETYDRQNTQ

Enzyme Prediction     

No EC number prediction in MGYG000002513_00489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	349	8.5e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.10e-102	44	453	1	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.31e-88	48	390	4	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.09e-51	89	349	27	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.97e-16	111	452	97	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXO65760.1	0.0	1	628	1	628
QXO80921.1	0.0	1	628	1	628
QXO77100.1	0.0	1	628	1	628
QXO54298.1	0.0	1	628	1	628
QWM00273.1	0.0	1	626	1	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	2.09e-122	37	619	35	633	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.54e-122	37	619	9	607	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.38e-121	37	619	39	637	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.22e-78	43	558	10	503	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	4.22e-48	88	350	58	311	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.15e-121	37	619	35	633	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	9.08e-74	44	450	16	432	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B4SRK3	2.79e-35	85	349	21	277	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	2.79e-35	85	349	21	277	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q65VK7	4.43e-34	85	365	23	293	Beta-hexosaminidase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000350	0.998988	0.000196	0.000152	0.000154	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002513_00489.