CAZyme Information: MGYG000002512_03284

Basic Information

• Species: Morganella morganii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii
• CAZyme ID: MGYG000002512_03284
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42374.45	6.9407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002512	3906921	Isolate	not provided	not provided

• Gene Location: Start: 3387527; End: 3388681 Strand: -

Full Sequence      

MSVSPRPLTIGIVAGETSGDILGAGLMRALKEKYPDVRFFGVAGPLMQAEGCETWYEMEE
LAVMGIVEVLGRLPRLLSIRRDLTRRFRELQPDVFVGIDAPDFNITLEGRLKSSGIKTIH
YVSPSVWAWRQNRVFKIAKATNLVLAFLPFEKAFYDKYNVPCRFIGHTMADALPLQPDKT
AARDALGLDPSVPCLAILPGSRHAEVSMLSGDFLKTAQLLRQALPDLQIVVPLVNAKRRA
EFEAIKQEIAPELDVHLLDGRARDAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFT
FWLAKRLVKTSYVSLPNLLAGREIVPELLQDECRSDLLANALLPLLQGGEAVDKLRETFL
ELHQKIRLDADNQAAQAVSDIASN

Enzyme Prediction     

No EC number prediction in MGYG000002512_03284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	10	366	1e-140	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	9	381	7	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	7	383	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	7	382	1	375	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.60e-176	10	378	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.17e-56	12	329	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG72155.1	1.28e-277	1	384	1	384
QCY22462.1	1.28e-277	1	384	1	384
SQL29375.1	1.28e-277	1	384	1	384
QWL85324.1	1.28e-277	1	384	1	384
AGG29993.1	1.28e-277	1	384	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.92e-210	6	382	5	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.30e-209	6	382	5	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N8N4	5.40e-217	4	382	9	387	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
B5Y1I9	1.02e-215	5	382	4	381	Lipid-A-disaccharide synthase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=lpxB PE=3 SV=1
B6HZF6	1.97e-215	6	382	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1
B7LGP4	1.97e-215	6	382	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=lpxB PE=3 SV=1
B7LW61	1.97e-215	6	382	5	381	Lipid-A-disaccharide synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002512_03284.