CAZyme Information: MGYG000002508_01679

Basic Information

• Species: Hafnia alvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia alvei
• CAZyme ID: MGYG000002508_01679
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000002508_1|CGC14	84006.24	7.4314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002508	4498956	Isolate	South Korea	Asia

• Gene Location: Start: 1808807; End: 1811029 Strand: +

Full Sequence      

MDWMVDAFTTYLYGIKIIAITLAILMLISGVDDLFIDVVYWSRRIWRSLTTYKKHKHLSH
KELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFVGTYPNDPDTQRDVDEV
CARFPNIHKVVCARPGPTSKADCLNNVLDAILQFEQSANFKFSGFILHDAEDVISPMELR
LFNYLVERKDLIQIPVYPFERPWTSFTSLTYLDEFAEQHGKDVPVREVIAGQVPSAGVGT
CFSRRAVMALLADGDGIAFDVQSLTEDYDIGFRLKEKGMKEIFVRFPVLPDGVKPHSTPF
GQRARSANVICVREYFPDTYSTAVRQKSRWIIGIVFQGFKTHHWSSSPMMNYFLWRDRKG
AINNFLSFFAMLVMIQLTLLALYQRFWPDAWHFLSIFTGDVWLYTLLWINFGLMVNRMFQ
RVVFVTVYYGLRQGLMSILRLFWGNLINFMANWRALRQVIQHGDPRRVAWDKTTHDFPSV
GQNRALRLLGSILIEQGAVTQEQLEDALVNRIPGLKLGNTLVHRGIITPMQLAQALAVQN
DVTAESIDERKIDPALIAKVPASVALHYAALPIREENGKMIFASESAIDPVSLAALARKV
GKRVSYVIAPSGQVVVGLRHWYARLRGKDHYAMLERAVAEKWLTQEQSESIWASFVSRQL
LFAEILASLGSIDGASLKALLLRHERSVLPLGEFLVTENVVSQETLNRALEIQKELQPTL
ASLLAQAGLSQEQIQMLEAA

Enzyme Prediction     

No EC number prediction in MGYG000002508_01679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	165	381	3.1e-44	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11234	nfrB	0.0	8	734	2	725	phage adsorption protein NrfB.
PRK14716	PRK14716	0.0	1	511	1	502	glycosyl transferase family protein.
PRK15489	nfrB	0.0	8	619	10	624	glycosyl transferase family protein.
pfam13632	Glyco_trans_2_3	7.25e-32	165	383	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
pfam13641	Glyco_tranf_2_3	2.00e-28	71	331	4	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLX29339.1	0.0	1	738	1	739
QLP26252.1	0.0	1	738	1	739
QLP30795.1	0.0	1	738	1	739
BCG32912.1	0.0	1	738	1	739
QJU25137.1	0.0	1	738	1	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJF_G	1.75e-07	489	622	7	146	Thermusthermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8],6EJF_H Thermus thermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8],6EJF_I Thermus thermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8],6EJF_M Thermus thermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8],6EJF_Q Thermus thermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8],6EJF_R Thermus thermophilus PilF ATPase (apoprotein form) [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AFA5	0.0	1	738	1	739	Bacteriophage adsorption protein B OS=Escherichia coli (strain K12) OX=83333 GN=nfrB PE=4 SV=1
P0AFA6	0.0	1	738	1	739	Bacteriophage N4 adsorption protein B OS=Escherichia coli O157:H7 OX=83334 GN=nfrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	31
361	383
393	415
422	444