CAZyme Information: MGYG000002503_02202

Basic Information

• Species: Enterobacter ludwigii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter ludwigii
• CAZyme ID: MGYG000002503_02202
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42379.47	7.2031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002503	4697885	Isolate	Australia	Oceania

• Gene Location: Start: 18159; End: 19307 Strand: -

Full Sequence      

MVDSRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPLMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKQKGIKTIHY
VSPSVWAWRQKRVFKIGRSTNLVLAFLPFEKAFYDKFNVPCRFIGHTMADAMPLDPDKNA
ARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQILRKTYPDLEVVVPLVNAKRREQ
FERIKAEVAPDLHVHLLDGKGREAMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTDYVSLPNLLAGRELVKELLQDECEPQALADALLPLLADGKTSHQMHDTFRE
LHQQIRCNADEQAAEAVLELAK

Enzyme Prediction     

No EC number prediction in MGYG000002503_02202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	366	4.6e-141	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	380	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	382	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	6	382	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	0.0	9	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.51e-49	11	328	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDE48900.1	9.41e-279	1	382	1	382
AWC83405.1	9.41e-279	1	382	1	382
QCV78725.1	9.41e-279	1	382	1	382
QLA05938.1	2.70e-278	1	382	1	382
QLO87803.1	2.70e-278	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.16e-257	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.88e-256	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4W6S7	3.58e-268	1	382	1	382	Lipid-A-disaccharide synthase OS=Enterobacter sp. (strain 638) OX=399742 GN=lpxB PE=3 SV=1
A8ALA6	8.07e-265	1	382	1	382	Lipid-A-disaccharide synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lpxB PE=3 SV=1
Q8ZRN9	2.70e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=lpxB PE=3 SV=1
B6HZF6	7.73e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1
B7LGP4	7.73e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002503_02202.