CAZyme Information: MGYG000002502_02260

Basic Information

• Species: Enterobacter chengduensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter chengduensis
• CAZyme ID: MGYG000002502_02260
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000002502_16|CGC3	62884.89	6.2069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002502	5337674	Isolate	France	Europe

• Gene Location: Start: 149101; End: 150786 Strand: -

Full Sequence      

MIRPRTLRPAFLPLALGSALLGMTTMGYADDSPASQTTSPDILLGPLFSDVQTAKLFPDQ
KTFADAVPKSDPLMILADYRMQRTQSSFDLRHFVEMNFTLPSEGEKYVPPAGQSLRQHID
DLWPVLTRTTDKASNKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKISD
MVDNFAYEIDAFGHIPNGNRSYYLSRSQPPFFSLMVELLATHDSDALKKYRPQMEKEYAY
WMDGVDALQPGQANKRVVKLDDGAVLNRYWDDRDTPRPESWLDDVNTAKSNPNRPATEIY
RDLRSAAASGWDFSSRWMDDPKKLGTIRTTSIVPVDLNALMFRMEKLLARASQESGDAAS
ANRFEALATARQKAIESHLWNDKEGWYADYDLKSKKVRNQLTAAALFPLYVKAAAQDRAD
KVAAATSSRLLQPGGIATTTVNSGQQWDAPNGWAPLQWVAAEGLQNYGKEKVSMDVTWRF
LKNVQHTYDREKKLVEKYDVSTTGTGGGGGEYPLQDGFGWSNGVTLKMLDRVCPKEKPCD
SVPENRPAANDEAVPVKATAQ

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	56	531	1.4e-187	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	33	529	48	543	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	4	530	8	534	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	31	538	45	558	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	1	561	1	565	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	55	531	1	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZV06120.1	0.0	1	561	1	561
BBJ68001.1	0.0	1	561	1	561
QBN10813.1	0.0	1	561	1	561
QFQ84955.1	0.0	1	561	1	561
AKZ73551.1	0.0	1	561	1	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	0.0	40	547	10	517	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	0.0	30	556	37	563	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	2.58e-311	40	547	10	517	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	1.17e-83	55	530	36	552	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.74e-82	55	530	36	552	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0Q337	0.0	2	549	6	556	Periplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=treA PE=3 SV=1
Q0TIH3	0.0	1	557	1	557	Periplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=treA PE=3 SV=1
P59765	0.0	2	549	6	556	Putative periplasmic trehalase OS=Salmonella typhi OX=90370 GN=treA PE=5 SV=2
C4ZTN8	0.0	1	547	1	547	Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treA PE=3 SV=1
Q1RCP3	0.0	1	557	1	557	Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000454	0.998551	0.000356	0.000261	0.000191	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002502_02260.