CAZyme Information: MGYG000002496_01890

Basic Information

• Species: Salmonella bongori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella bongori
• CAZyme ID: MGYG000002496_01890
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002496_9|CGC1	62051.4	9.7471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002496	4572147	Isolate	Italy	Europe

• Gene Location: Start: 48299; End: 49945 Strand: +

Full Sequence      

MMKSIRYYLAFAAFIALYYIIPVNSRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYF
EKPIAGYWINSLGQWLFGATNFGVRAGAILTTLLTAVLVAWLTFRLWRDKRTALLASVIF
LTLFAVYSIGTYAVLDPMIALWLTAGMCCFWQGIQARTRTGKMGMFLLLGATCGLGVLTK
GFIALAVPVVSVLPWVVVQKRWKDFLLYGWLAVLSCVVVVFPWALAIARREADFWHYFFW
VEHIQRFAMSNAQHKAPFWYYLPVLIVGCLPWLGLLPGALKLGWRDRNSAFYLLGWTIMP
VFFFSIAKGKLPTYILSCFAPIAMLMARFVLYNVKQGVAALRINGGLNLGVGLIGIIATF
VVSSWGPLKSPVWTHIETYKVFCAWGAFTVWAFVGWYSRFNSQKYLLPALCPLGLALLFG
FSIPDRVMESKQPQFFVDMTWAPLASSRYILADSVGVGAGLAWSLKRDDIILYGHAGELR
YGLNYPDVHNKFVNAGDFKHWLNQHRQEGIITLVLSPDKDEDISTLAIPPADNIDYLGRL
VLIQYRPK

Enzyme Prediction     

No EC number prediction in MGYG000002496_01890.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	516	1.1e-147	0.9592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	547	1	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	2.10e-100	6	521	8	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	7.33e-46	4	238	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	3.91e-08	62	223	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGR59600.1	0.0	1	548	1	548
QXY86249.1	0.0	1	548	1	548
QVP38688.1	0.0	1	548	1	548
QQP76472.1	0.0	1	548	1	548
CCC31151.1	0.0	1	548	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.98e-37	11	423	37	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5R274	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=arnT PE=3 SV=1
C0Q067	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=arnT PE=3 SV=1
B5RCC6	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=arnT PE=3 SV=1
O52327	0.0	2	548	1	547	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=arnT PE=1 SV=2
B5FNU1	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000021	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	29
82	104
113	135
139	156
168	190
205	227
258	280
290	307
314	331
346	368
381	400
405	424