CAZyme Information: MGYG000002495_04354

Basic Information

• Species: Citrobacter europaeus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter europaeus
• CAZyme ID: MGYG000002495_04354
• CAZy Family: CE8
• CAZyme Description: Putative acyl-CoA thioester hydrolase YbhC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000002495_1|CGC58	46019.51	6.8614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002495	5258449	Isolate	United States	North America

• Gene Location: Start: 4620876; End: 4622159 Strand: +

Full Sequence      

MNISSVSRLALAMAFGVTLTACSSTPPDQIPSDQTAPGTSSRPILSANEAKNFVAAHYFS
ALTPNTAPWSPSAISLPAQPDFVVGPAGTQGVTHTSIQAAVDAAIIKRTNKRQYIAIMPG
EYQGTVYIPAATGSLTLYGMGEKPLDVKIGQAIDGDMSTADWRRTVNPGGKYMPGKPAWY
MFDNCQNKRGANIGVMCSAVVWSQNNGLQLQNLTIENNLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLENDRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFTASGDGVAQLGRSLDVDSNTNGQVVIR
DSVINEGFNMAKPWADSVIAKHPFAGNTGAEDDKGEIQRNLNDTNFNRMWEYNNRGIGSK
VVAEPKK

Enzyme Prediction     

No EC number prediction in MGYG000002495_04354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	90	420	4.3e-54	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	0.0	1	421	1	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PRK10531	PRK10531	0.0	1	420	1	422	putative acyl-CoA thioester hydrolase.
pfam01095	Pectinesterase	2.46e-11	81	419	1	266	Pectinesterase.
PLN02708	PLN02708	4.11e-09	69	306	216	413	Probable pectinesterase/pectinesterase inhibitor
PLN02488	PLN02488	7.25e-09	81	427	198	482	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APR33891.1	2.79e-312	1	427	1	427
AUT97909.1	2.79e-312	1	427	1	427
ARC40869.1	1.14e-311	1	427	1	427
ATX02218.1	1.14e-311	1	426	1	426
QSF23414.1	6.29e-309	1	426	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GRH_A	4.28e-252	29	427	24	422	Crystalstructure of escherichia coli ybhc [Escherichia coli K-12]
4PMH_A	1.22e-62	33	419	1	366	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46130	8.64e-269	1	427	1	427	Putative acyl-CoA thioester hydrolase YbhC OS=Escherichia coli (strain K12) OX=83333 GN=ybhC PE=1 SV=2
Q47474	1.15e-115	1	413	1	426	Pectinesterase B OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemB PE=1 SV=2
P55743	1.57e-107	35	414	5	396	Pectinesterase B OS=Pectobacterium parmentieri OX=1905730 GN=pemB PE=3 SV=2
E7CIP7	1.02e-61	33	419	17	382	Pectinesterase OS=Sitophilus oryzae OX=7048 GN=CE8-1 PE=1 SV=1
P58601	5.13e-30	39	419	30	394	Pectinesterase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pme PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002495_04354.