CAZyme Information: MGYG000002492_02289

Basic Information

• Species: Agathobacter rectalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter rectalis
• CAZyme ID: MGYG000002492_02289
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000002492_1|CGC25	34555.17	4.5303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002492	3449685	Isolate	not provided	not provided

• Gene Location: Start: 2385356; End: 2386267 Strand: -

Full Sequence      

MSVHITKTYNIGGLIGLRQNAVKNAGETLGFKEMSLFKFPDTYDSDDELHVRMDGIIASL
CPEDIVIFQHPSGESPRYDGFLFEHLRRYHGTKIVAFIQEIASDRDDSEYSLSDEITLLN
RADMFIFASAALRDYYIANGLKEKPYLIQNIPDYMTDICANEHKNKKLYIMAETSQNEYP
LNNLNIEVVQYDEYHVTESILRLSDGGFGLIWDTDEQALGLYMAAGIPVIVKKGLSCEKY
VTDNEIGAAATDFEDVYRIAVSESEDKLSQYYANVKKLQDLFINGIYTRKLLLDTLILCR
ERL

Enzyme Prediction     

No EC number prediction in MGYG000002492_02289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	19	294	1.2e-37	0.9440993788819876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	8.65e-52	1	298	1	332	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR76247.1	3.95e-222	1	303	1	303
CBK91592.1	5.78e-215	1	303	1	303
CBK92847.1	5.78e-215	1	303	1	303
ACR76248.1	8.45e-50	1	297	1	327
CBK92848.1	1.67e-49	1	297	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	9.10e-42	1	294	3	324	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	1.95e-30	1	295	3	325	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.21e-30	1	295	11	333	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0M3KKZ0	4.76e-41	1	294	1	322	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
A0A0H2UR93	2.44e-37	1	296	1	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B5A7L9	1.03e-29	1	295	1	323	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
Q9AEU1	2.98e-29	1	294	1	327	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.51e-25	1	294	1	327	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002492_02289.