CAZyme Information: MGYG000002491_02246

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_02246
• CAZy Family: CE8
• CAZyme Description: Pectinesterase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		45767.19	8.1073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 149643; End: 150893 Strand: +

Full Sequence      

MTRRPYLGMSTLLCMPLVLQGCAAASSTGTATRPLLTAQEAAPYTVENYFAQGGLSDRPR
GPWRPAAITLENINTPWRVAPSGAPFTRIQPAIDAAIAQHQGAERLYIRIEPGVYVGTVY
IPDDAPPITIFGAGNGPEAVRIEFAIDSQFSPATYRQTVNAEDYPPGSPAYYQYALCAGK
TTSQIGTNCAAVFWSQSHDFQLVNLTIANSLLDTVDGGTHQGVALRTDGDRVQLKNMRLL
GRQDTLYLNVSNRRNDALTDRIHRVYVQDSYIEGDVDYVFGRANAVFDRVHFHTVSSRKS
PEAYVLAPNTLPDNPYGFLVKNSRFTTDEGYKGTFKARLGRAWDQGAGKTGYLPGNTANG
QVLIVDSVIDGGYDRLSPWGAAATTARPFNGNAQPSRQLNDVNHNRLWEWNTRWQR

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	81	370	4.1e-57	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10531	PRK10531	1.26e-180	19	413	28	417	putative acyl-CoA thioester hydrolase.
COG4677	PemB	5.35e-101	25	413	34	399	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	7.66e-22	78	319	8	220	pectinesterase
PLN02682	PLN02682	3.32e-19	81	343	77	289	pectinesterase family protein
PLN02432	PLN02432	6.95e-18	78	343	14	214	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR20754.1	8.27e-313	1	416	1	416
BBS91612.1	3.23e-310	1	416	1	416
BBR59057.1	3.23e-310	1	416	1	416
QIR27507.1	6.74e-271	1	416	1	416
QGH30046.1	1.78e-253	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GRH_A	7.53e-94	29	413	33	410	Crystalstructure of escherichia coli ybhc [Escherichia coli K-12]
4PMH_A	3.41e-80	29	411	6	360	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]
3UW0_A	1.16e-12	186	377	110	307	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.91e-07	183	377	81	283	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47474	5.64e-162	6	412	6	427	Pectinesterase B OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemB PE=1 SV=2
P55743	1.99e-149	29	411	8	395	Pectinesterase B OS=Pectobacterium parmentieri OX=1905730 GN=pemB PE=3 SV=2
P46130	4.78e-93	29	413	38	415	Putative acyl-CoA thioester hydrolase YbhC OS=Escherichia coli (strain K12) OX=83333 GN=ybhC PE=1 SV=2
E7CIP7	2.99e-79	29	411	22	376	Pectinesterase OS=Sitophilus oryzae OX=7048 GN=CE8-1 PE=1 SV=1
P24791	5.23e-45	24	389	24	372	Pectinesterase OS=Ralstonia solanacearum OX=305 GN=pme PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000009	0.000247	0.925781	0.000232	0.073722	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_02246.