CAZyme Information: MGYG000002490_03653

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_03653
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		24670	6.0583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 59525; End: 60193 Strand: +

Full Sequence      

MALTAHTLNTQIRKTVHIQYLLHLPAQYDASSDQKWPVLLFLHGAGERGNDLEKVKVHGP
PKLAEHTDLPFIIIAPQCPEHSHWQVEMDAVIALLDEVTAAYRADTDRIYVTGLSMGGFG
TWSLGIAYPDRFAALVPICGGHNPQQVSLLKQVPVWVFHGAKDTVVPLSQSEAMVEALRE
AGGDVKLTVYPEAGHDSWTETYNSDGLYDWLLQHSLRSRAER

Enzyme Prediction     

No EC number prediction in MGYG000002490_03653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	17	198	1.2e-34	0.8898678414096917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.00e-52	16	216	172	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	9.38e-17	18	215	378	617	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	3.66e-15	85	214	42	209	Prolyl oligopeptidase family.
pfam01738	DLH	8.20e-13	83	195	68	185	Dienelactone hydrolase family.
COG0412	DLH	1.04e-12	85	209	86	215	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW99051.1	1.94e-71	3	212	29	236
VTR91196.1	1.67e-70	11	213	36	236
QDU56037.1	1.34e-68	18	213	801	1004
BCI61582.1	1.63e-46	20	212	827	1039
ABS60377.1	1.33e-42	36	212	37	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.61e-46	16	215	156	379	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	2.21e-33	17	222	20	223	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4H0C_A	2.65e-08	39	195	25	194	ChainA, Phospholipase/Carboxylesterase [Dyadobacter fermentans DSM 18053],4H0C_B Chain B, Phospholipase/Carboxylesterase [Dyadobacter fermentans DSM 18053]
1JJF_A	1.03e-07	23	143	51	181	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.56e-07	23	143	51	181	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZAL4	2.24e-09	102	216	124	257	Putative carboxymethylenebutenolidase OS=Yersinia pestis OX=632 GN=YPO3787 PE=3 SV=1
P71505	3.55e-09	87	216	145	290	Putative carboxymethylenebutenolidase OS=Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) OX=272630 GN=MexAM1_META1p1735 PE=3 SV=2
B8YG19	2.65e-08	37	210	73	244	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
D4AR77	2.28e-07	25	220	396	629	Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06907 PE=1 SV=2
P52090	4.41e-07	17	207	50	288	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_03653.