CAZyme Information: MGYG000002488_02832

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_02832
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177		19796.23	6.4803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 17049; End: 17582 Strand: -

Full Sequence      

MLSADFIKTAQLLKQQIPSLHIVVPLVNAKRRAQFEQIHQNVAPELEIQLLDGRAREAMT
ASDATLLASGTAALECMLTKCPMVVGYRMKPFTFWLAKRLVKTPYVSLPNLLAGREIIKE
LLQEECEPSALAQQLLPLLTDEEKVHQLKEIFLQLHSAIRCNADEQAANAVLELAEK

Enzyme Prediction     

No EC number prediction in MGYG000002488_02832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	160	1.1e-50	0.4293785310734463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.59e-84	1	177	202	377	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	1.70e-67	1	174	207	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	1.37e-65	1	177	204	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.38e-62	2	171	202	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	5.81e-06	57	122	484	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT33016.1	5.31e-116	1	177	214	390
QNH65136.1	2.15e-115	1	177	214	390
QQP26649.1	1.42e-113	1	177	214	390
QPB80642.1	1.42e-113	1	177	214	390
QIF88732.1	2.02e-113	1	177	214	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.54e-85	1	176	207	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.15e-84	2	176	208	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N8N4	8.82e-88	1	177	213	389	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
A9N0T2	6.60e-86	1	176	207	382	Lipid-A-disaccharide synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=lpxB PE=3 SV=1
A8ALA6	1.32e-85	1	176	207	382	Lipid-A-disaccharide synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lpxB PE=3 SV=1
C0Q6K5	3.76e-85	1	176	207	382	Lipid-A-disaccharide synthase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=lpxB PE=3 SV=1
B5R421	3.76e-85	1	176	207	382	Lipid-A-disaccharide synthase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_02832.