CAZyme Information: MGYG000002485_02289

Basic Information

• Species: Fusobacterium_A mortiferum
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A mortiferum
• CAZyme ID: MGYG000002485_02289
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189	MGYG000002485_4|CGC1	20667.17	5.646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002485	2635424	Isolate	not provided	not provided

• Gene Location: Start: 47406; End: 47975 Strand: -

Full Sequence      

MKRLALLTLFCSLATGVIAAPNDGWNEGMILFKKGDTTNTNYYRIPAITTTSQGTIIAVA
DYRHNGYGDIGLNTGVDFAIKISHDGGNTWSDKTIITPENGLGISDPAIVHNSDTGRTFL
FGYQNDKFITTKPTSEKSDFFMYTSDDGGKTWDKGQSLKDLTPEGYKYVLQGPGSGMYYN
GTIYMPIQA

Enzyme Prediction     

No EC number prediction in MGYG000002485_02289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	32	188	5.9e-35	0.47076023391812866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.44e-30	31	189	3	164	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4409	NanH	5.25e-08	29	117	261	346	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	1.84e-05	46	185	202	320	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.33e-05	46	156	54	154	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.17e-04	82	187	24	128	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18135.1	2.16e-141	1	189	7	195
AIJ09625.1	2.65e-68	2	189	3	201
AMZ14174.1	2.29e-67	22	189	7	176
QPR26713.1	5.62e-62	19	189	28	200
BAU80413.1	8.19e-62	21	189	6	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q6K_A	4.68e-13	43	188	184	346	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
3SIL_A	5.34e-13	27	188	17	191	ChainA, SIALIDASE [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],7AEY_AAA Chain AAA, Sialidase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
1DIL_A	5.37e-13	27	188	19	193	SialidaseFrom Salmonella Typhimurium Complexed With Apana And Epana Inhibitors [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],1DIM_A Sialidase From Salmonella Typhimurium Complexed With Epana Inhibitor [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],2SIL_A Chain A, SIALIDASE [Salmonella enterica subsp. enterica serovar Typhimurium],2SIM_A Chain A, Sialidase [Salmonella enterica subsp. enterica serovar Typhimurium]
6MYV_A	6.36e-13	43	188	181	343	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	6.45e-13	43	188	202	364	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15698	7.62e-14	4	188	13	210	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P29768	2.95e-12	27	188	20	194	Sialidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nanH PE=1 SV=4
Q27701	2.37e-11	28	188	277	450	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
P31206	5.47e-11	39	188	199	365	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	1.05e-10	43	177	67	210	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999082	0.000183	0.000169	0.000162	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002485_02289.