CAZyme Information: MGYG000002484_03904

Basic Information

• Species: Cronobacter malonaticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter malonaticus
• CAZyme ID: MGYG000002484_03904
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002484_209|CGC2	33539.18	10.0303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002484	4470595	Isolate	Czech Republic	Europe

• Gene Location: Start: 34414; End: 35307 Strand: +

Full Sequence      

MKVSFFLLKFPVASETFVLNQIVGFINMGYEVEIVSLQKGDLKNTHAAYTEYNLAQKTRF
LLEEPEGKAAKLKYRASHTARGLFNARTWRALNMARYGDEARNLILSAICGRVPGTLKAD
VFIAHFGPAGVTAAKLRELGVLDGKIATVFHGIDVSHREVLTRYTPEYQQLFRRGDLMLP
ISELWAERLKAMGCPQEKIAVSRMGVDMEKFSLRPLKQPGTPLEIISVARLTEKKGLHVA
IEACRLLKGRGVDFRYNILGTGPWERRLHTLIEQYGLEDCVFMPGFKXXXXXXXXTK

Enzyme Prediction     

No EC number prediction in MGYG000002484_03904.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04005	wcaL	0.0	1	287	1	287	colanic acid biosynthesis glycosyltransferase WcaL. This gene is one of the glycosyl transferases involved in the biosynthesis of colanic acid, an exopolysaccharide expressed in Enterobacteraceae species.
PRK15427	PRK15427	0.0	1	287	1	287	colanic acid biosynthesis glycosyltransferase WcaL; Provisional
cd03799	GT4_AmsK-like	4.23e-75	2	287	1	239	Erwinia amylovora AmsK and similar proteins. This is a family of GT4 glycosyltransferases found specifically in certain bacteria. AmsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor.
cd05844	GT4-like	5.29e-22	66	271	43	238	glycosyltransferase family 4 proteins. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to glycosyltransferase family 4 (GT4). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03811	GT4_GT28_WabH-like	2.40e-17	15	287	15	253	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHB69823.1	4.30e-208	1	287	1	287
QXL92163.1	4.30e-208	1	287	1	287
AGE85715.1	4.30e-208	1	287	1	287
ALX78041.1	4.30e-208	1	287	1	287
AKE95450.1	4.30e-208	1	287	1	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71243	3.75e-156	1	287	1	287	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2
P26388	2.89e-153	1	287	1	287	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wcaL PE=3 SV=1
Q46638	1.29e-91	1	287	1	288	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002484_03904.