CAZyme Information: MGYG000002484_03610

Basic Information

• Species: Cronobacter malonaticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter malonaticus
• CAZyme ID: MGYG000002484_03610
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		82048.11	5.9117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002484	4470595	Isolate	Czech Republic	Europe

• Gene Location: Start: 29605; End: 31821 Strand: +

Full Sequence      

MVNRITATSPGAPGSLLFWALRGEEKLSAPFRFEVDLLSDDFTLNRQQLLGQPMTVTIPT
QTLNPRYLTGNITAVAVRSEEIDSKRYAVYQLTLEPDFWAMTRDRNFRIFQQQRVPDIVK
TLFSEHNVKFEDQLTRSYRQWDYCVQYAESSFDFISRLLELEGISYLFRHDKDGHTLVLM
DDYTRAIPFPGYEVIAWHATSGGGVVKEEGVSQLTASHVVTPGLYSTDDYDFRKPHAWML
QTMQNPVSPSPGKIDVYDWPGRFVEHGDGEAYARIRQQAWQAQQQQTRGSGTASGIAPGH
TFRLIKAPHVADNTDWLVVGAEYEFEENPYTSGGLGEGRQRIDFTVIPAQTPFRPALVTP
WPRTYGPQTARVVGPKGESIWTDRYGRVKVKFHWDRFSQGDENSSCWVRVSSAWAGQGFG
GIQIPRVGDEVVVDFINGEPDRPIIIGRVYNEARMPPWELPAAATQMGFMSRSKDGSPDN
ANALRFEDKPGQEQFWLHAERNMDTEVEQDETHSVGSNRTKTVGKDETSHIKQNRTRTVD
GNETVTVGQNRTKTIQGSETTTVNQHRTETVKGNETLSVEQNRDETITGNHTATVKSNQT
GIVDGNQTLTVNQDRTRTVNGNEKVQVQQNRTVSVTGNQTLNVTGNRDVTVSANENRVVS
QKQVVSIGAGRTLTITGGDTRFTEGSVADSATTTFQINVGESGILISNGSIEITAGGASI
TINAAGVMVNGKKIELNA

Enzyme Prediction     

No EC number prediction in MGYG000002484_03610.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3501	VgrG	0.0	11	546	20	550	Uncharacterized conserved protein, implicated in type VI secretion and phage assembly [Intracellular trafficking, secretion, and vesicular transport, Mobilome: prophages, transposons, General function prediction only].
TIGR03361	VI_Rhs_Vgr	0.0	5	520	1	513	type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
TIGR01646	vgr_GE	4.23e-145	21	502	6	483	Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
pfam05954	Phage_GPD	5.60e-89	24	329	1	305	Phage late control gene D protein (GPD). This family includes a number of phage late control gene D proteins and related bacterial sequences. This family also includes Bacteriophage Mu P proteins and related sequences.
PHA02596	5	1.25e-19	486	678	404	571	baseplate hub subunit and tail lysozyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVF15566.1	8.31e-248	1	523	1	521
AOP82981.1	8.31e-248	1	523	1	521
AOP96031.1	1.13e-246	1	523	1	521
AVG77406.1	1.22e-246	1	524	1	526
AVE75420.1	1.34e-246	1	523	1	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q5P_A	1.38e-143	10	524	15	528	ChainA, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_B Chain B, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_C Chain C, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5]
4MTK_A	1.38e-139	1	516	3	517	Crystalstructure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_B Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_C Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_D Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_E Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_F Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],6H3L_A Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_B Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_C Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3N_A Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_B Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_C Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1]
4UHV_A	4.23e-137	1	516	3	517	Thestructure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1],4UHV_B The structure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1]
2P5Z_X	2.46e-32	23	453	35	474	TheE. coli c3393 protein is a component of the type VI secretion system and exhibits structural similarity to T4 bacteriophage tail proteins gp27 and gp5 [Escherichia coli O6]
7AEF_q	4.26e-07	101	473	119	475	Chainq, Phosphoserine phosphatase SerB [Algoriphagus machipongonensis],7AEF_r Chain r, Phosphoserine phosphatase SerB [Algoriphagus machipongonensis],7AEF_s Chain s, Phosphoserine phosphatase SerB [Algoriphagus machipongonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I0F3	1.10e-145	9	523	51	564	Type VI secretion system spike protein VgrG1c OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1c PE=1 SV=1
Q9I737	1.88e-144	5	523	10	527	Type VI secretion system spike protein VgrG1b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1b PE=3 SV=1
Q9I741	7.55e-139	1	516	3	517	Type VI secretion system spike protein VgrG1a OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1a PE=1 SV=1
Q9HYC3	1.30e-91	23	523	28	532	Type VI secretion system spike protein VgrG4b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG4b PE=3 SV=1
Q9HU93	1.82e-81	20	523	25	532	Type VI secretion system spike protein VgrG5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002484_03610.