CAZyme Information: MGYG000002481_03714

Basic Information

• Species: Stenotrophomonas maltophilia_F
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_F
• CAZyme ID: MGYG000002481_03714
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		36379.48	6.3661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002481	4867831	Isolate	United States	North America

• Gene Location: Start: 52000; End: 53007 Strand: +

Full Sequence      

MSQDRESQLLRQATEAGMTSSRELANFMAQAGHESRGLSRLNESFNFTRGISQIPVEAAW
RNGNGALESARQEALRGRPENLAELMYGGRMGNDAPGDALKYHGRGYLPLVGKENYERAG
KALDLDLVNQPELAAQPEHAGRIAVWQWQTRVPEAAREDVREATRALNGALNGIEARQQR
FDVWQQKLTPDVMARLERGEVGAPAQPTTGRDMSQPGEPGYTLFSGARQHLQQMGPQSGL
RSVQELDNAAGALALSAQKAGMSRIDHLLAGNDGRTLFAVQGALGDPAMLRASVDREQAA
QQPLAQSSQQLAANVAQQDPAAALAREQEQRSRSL

Enzyme Prediction     

No EC number prediction in MGYG000002481_03714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	18	160	4.3e-31	0.47619047619047616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	7.89e-31	11	181	29	197	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	3.42e-09	22	171	47	190	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.38e-08	19	150	48	156	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB78877.1	5.25e-234	1	335	1	335
QCB35470.1	6.13e-233	1	335	1	335
QGL85045.1	6.13e-233	1	335	1	335
QNG87755.1	7.15e-232	1	335	1	335
QNG89785.1	7.15e-232	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	1.55e-27	15	181	45	215	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
7MU9_A	1.13e-18	210	312	1	103	ChainA, VirD4 interacting protein conserved domain [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	8.45e-17	12	177	28	187	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
P29021	1.05e-06	85	150	110	169	Acidic endochitinase OS=Petunia hybrida OX=4102 PE=2 SV=1
Q10S66	1.07e-06	102	160	121	181	Chitinase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht11 PE=2 SV=1
O24598	2.75e-06	99	177	159	244	Endochitinase At2g43580 OS=Arabidopsis thaliana OX=3702 GN=At2g43580 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002481_03714.