CAZyme Information: MGYG000002481_00236

Basic Information

• Species: Stenotrophomonas maltophilia_F
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_F
• CAZyme ID: MGYG000002481_00236
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	MGYG000002481_6|CGC1	50030.14	8.0959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002481	4867831	Isolate	United States	North America

• Gene Location: Start: 122473; End: 123828 Strand: -

Full Sequence      

MKRREFIAASAAVAASSLLPQTAAWARGRKVRLAMIGTGMRGLVLLKELVRRDDVEVVAL
CDIEPIMLGRATEMVAKAGKPAPKTYGQDRDTNAWKRLLEQKGIDGVIIATPWEYHAPMS
IAAMQAGVAVGCEVVAGITLQDHWDVLKTQLSTGTPYMLLENVCYRRDVMAALQMVRQGL
FGELVHLQAGYQHDLRGVKFNSGDPNQPYDSGVEFGPKGWSEARWRTEHSVERNGELYPS
HGIGPCAMYTGINRGNRFTHINAFATKARGLHEYTVAKSGGTTHPSTKVKFKLGDIVTTT
LACENGETILLQHDTSLPRPYSMGFRVQGTKGLWMDVNHSIHIEGRSPPHQWEEFKKYQD
EYEHPLWKQNADTAASAGHGGMDWFVIHAFVEALKAKAPMPIDIYDAVTWSAITPLSEQS
IANGFQTLEFPDFTAGAWKTRKPIFAFDGKY

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	29	441	6.2e-171	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.66e-20	28	424	1	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.14e-09	31	133	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB80813.1	0.0	1	451	1	451
QGL86364.1	0.0	1	451	1	451
QCB34209.1	0.0	1	451	1	451
CCH14504.1	0.0	1	451	1	451
VEF35159.1	0.0	1	451	1	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.71e-157	29	451	19	444	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.11e-76	30	444	42	444	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	3.23e-09	29	203	4	171	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
6A3F_A	1.15e-07	82	237	72	207	Levoglucosandehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3F_B Levoglucosan dehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_A Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_B Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_C Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_D Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_A Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_B Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_C Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_D Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_A Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_B Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_C Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_D Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3]
3EC7_A	1.70e-06	27	154	20	138	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	0.0	1	451	4	454	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	1.48e-156	29	451	19	444	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	1.06e-144	31	446	53	467	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.13e-143	30	446	49	465	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A8H2K3	3.08e-93	31	444	53	451	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	1.000004	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002481_00236.