CAZyme Information: MGYG000002478_04018

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_04018
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000002478_1|CGC79	24218.45	5.437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 4798365; End: 4798991 Strand: -

Full Sequence      

MIEAVARECKRQGMKLGLYYSLWDRKVNADVDNVESDRKYNTYMLKQLDELMDITEKYTK
IVEFWFDGSWVKPGYRWPVEGIYRTIKSREPQCQIGINWTIGEDADPHNPNAPEKSYKII
PEEQKEGDPIRYFPSDFRLGDPLLPASLIRELDFKKNRMELVALHATGFGRPSQAAWTEI
FADGQSLRIARWPNLYGYDWKNTGIGDG

Enzyme Prediction     

No EC number prediction in MGYG000002478_04018.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	8.00e-10	5	112	133	246	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	7.11e-09	5	127	136	260	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR72916.1	2.48e-156	1	208	123	330
QJR68585.1	2.48e-156	1	208	123	330
QJR64319.1	2.48e-156	1	208	123	330
QJR77240.1	4.44e-151	1	208	123	325
AND21097.1	3.10e-139	1	191	123	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	4.70e-06	1	104	133	239	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_04018.