CAZyme Information: MGYG000002478_01885

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_01885
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000002478_1|CGC44	47089.78	7.2926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 2443411; End: 2444640 Strand: +

Full Sequence      

MKKNSICKIIVSGLLTAVPLMGMAQQVCGNKPWSVRMAESEMVRCPESWQLDFQTRLKWD
YCHGLELQAMLDVYDAYGDKKFFDYAVAYADTMIHQDGSIETYKLEEYNIDRLNSGKMLF
RIYEQTKDEKYKKALDLLRSQLDTHPRNADGGFWHKKIYENQMWLDGLYMGQPFYAEYAY
RNNRVNDYADIINQFVTVARHNYDPKTDLYRHACDVSKREKWADKTTGLSQHCWGRAMGW
YAMACVDVLDFIPEHEAGRESVIEILNKLVAQIKRTQDPATGVWYQVIDRSGDEGNYLES
SCSTMFVYTLLKALRKGYICPSYMEVAKKGYEGLLTQFIEVDNKGVVSITKGCAVAGLGG
KPVYRTGDYNYYITEKIRSNDAKAVGPFIMASLEWERLFQKNNCGTACK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	397	8e-122	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.31e-128	33	399	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.87e-106	53	399	28	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR58422.1	1.23e-315	1	409	1	409
AND19541.1	1.23e-315	1	409	1	409
AII65163.1	1.23e-315	1	409	1	409
ALA73614.1	1.23e-315	1	409	1	409
QJR56782.1	1.23e-315	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.61e-114	59	398	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.49e-78	58	400	38	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.22e-78	58	400	28	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.01e-21	147	398	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	3.09e-17	42	335	48	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.18e-78	58	400	38	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	8.14e-39	170	394	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.14e-39	170	394	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001876	0.995698	0.001583	0.000331	0.000256	0.000220

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_01885.