CAZyme Information: MGYG000002478_00206

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00206
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002478_1|CGC9	43934.95	7.6577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 330881; End: 332014 Strand: +

Full Sequence      

MMKKKLILSFFFVALGFGVVKAQDLPDKKETLKTVIKVNNYFMKKYADYRTPSFVKNVTR
PSNIWTRGVYYEGLMALYSVYPRDEYYKYAVDWSNYHEWGFRNGTTTRNADDYCASQTYI
DLYNICPDPERIRKVKANIDMLVNTPQVNDWWWIDAIQMGMPVFAKLGKLTGEQKYFDKM
WDMYEYTRNKHGENGMYNQKEGLWWRDQDFDPPYKEPNGKNCYWSRGNGWVYAALVRVLD
EIPTNEKHRADYINDFLTMSKAIKNCQRTDGFWNVSMHDESNFGGKETSGTALFVYGMAW
GVRNGLLDRKEYLPVLLEAWNAMVKDAVHPNGFLGLVQGTGKEPKDSQPVTYDKVPDFED
FGVGCFLLAGSEVYKLN

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	375	1.1e-91	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.70e-110	37	376	4	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.14e-55	42	376	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR73845.1	6.77e-299	1	377	1	377
ALA72223.1	6.77e-299	1	377	1	377
QJR69512.1	6.77e-299	1	377	1	377
AII66388.1	6.77e-299	1	377	1	377
AND18201.1	6.77e-299	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.91e-71	5	372	2	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	4.86e-63	22	372	3	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.42e-47	65	377	53	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.71e-15	61	376	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.95e-14	61	376	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.45e-52	65	377	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	9.12e-47	65	377	60	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	4.54e-35	109	377	135	412	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.58e-14	61	376	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000325	0.998887	0.000253	0.000166	0.000168	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00206.