CAZyme Information: MGYG000002477_00254

Basic Information

• Species: Citrobacter_A amalonaticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A amalonaticus
• CAZyme ID: MGYG000002477_00254
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209	MGYG000002477_2|CGC1	22794.22	10.8015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002477	5083867	Isolate	United States	North America

• Gene Location: Start: 161412; End: 162041 Strand: -

Full Sequence      

MDSKRLDNAALAAGISPNYINAHGKPQSIGAETKRRLLDAMHRTAAAAKVAVTAVPNVMV
YTAGKKMSLAVEGHGEFNWLLTTEEGGQFKGHATGGKSFTLPTKLPLGYHTLTLTQDEQR
HHCRIIVAPKRCYEPQALLTGQKLWGACVQLYTLRSEHNWGIGDFGDLKSMLVDVAKRGG
RLSASIRSTRSIRQTRRAPARTARLHVAG

Enzyme Prediction     

EC	2.4.1.25

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11052	malQ	1.18e-106	1	180	1	179	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	4.93e-30	1	180	3	208	malto-oligosyltrehalose synthase.
TIGR00217	malQ	6.38e-19	130	180	1	49	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	2.79e-16	132	180	1	49	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	7.82e-09	149	182	1	34	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIO37870.1	1.91e-123	1	180	1	180
SAZ25739.1	1.91e-123	1	180	1	180
AVC45104.1	1.91e-123	1	180	1	180
SAY71842.1	1.91e-123	1	180	1	180
BCU46833.1	1.91e-123	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	9.90e-103	1	180	1	179	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	5.75e-98	2	180	2	179	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	3.09e-11	78	179	116	212	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	5.17e-102	1	180	1	179	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.68e-17	76	179	81	183	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P65337	1.81e-12	91	180	122	210	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	1.81e-12	91	180	122	210	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	1.81e-12	91	180	122	210	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002477_00254.