CAZyme Information: MGYG000002470_04510

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04510
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1196		132567.57	5.456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 174; End: 3764 Strand: +

Full Sequence      

MKAIFKRTSLLLMGTLIGISTVQAQKSPQDMDRFIDALMKKMTVEEKIGQLNLPVTGDIT
TGQAKSSDVATKIEKGLVGGLFNLKGVDRILEVQKLAVEKSRLGIPLLFGMDVIHGYETI
FPIPLGLSCTWDMAAIEKSARIAAIEASADGISWTFSPMVDISRDPRWGRVSEGSGEDPF
LGGAIAQAMVYGYQGANQQDQLRRNDEIMACVKHFALYGAGEAGRDYNTVDMSRNRMFNE
FMYPYEAAVEAGVGSVMASFNEIDGIPATGNKWLLSDLLRGQWGFEGFVVTDFTGIAEMI
EHGVGDLQTVSALALNAGVDMDMVSEGFVGTLMKSIKEGKVRMGTLNTACRRILEAKYKL
GLFDNPYKYCDVNRPKRDIFTKEHRDAARRIAAESFVLLKNDAGVLPLKKQGTVAVIGPL
GNTRSNMPGTWSVAARLNDYPSLYEGLKEMMAGKVNITYAKGSNLIGDAAYEERATMFGR
SLNRDNRTDQELLDEALKVAAGADVIVAALGESSEMSGESSSRTELGLPDVQHTLLEALL
KTGKPVVLTLFTGRPLTLNWEQEHVPAILNVWFGGSEAAYAIGDVLFGDVNPSGKLTMTF
PKNVGQIPLFYNHKNTGRPLAEGKWFEKFRSNYLDVDNEPLYPFGYGLSYTNFQYSDIAL
STPTLGKDGSVTAVVTVTNTGKYDGAEVVQLYIRDLVGSITRPVRELKGFNKIFLRAGES
KTVSFTITRDLLRFYDYDMNYVAEPGDFNIMIGGNSQAVKTAKLTLTNPGNTAQLTDDAL
MDTVQRRTFNYFWEGAEPNSGLAPERIHMDGIYPEKDQNVVTSGGSGFGIMTILSGIDRG
YVTREEGLARMEKIVSFLEKADRFHGAYPHWWYGDTGKVKPFGQKDNGGDLVETAFLIQG
LLAVHQYYINGSPEEQALAKRIDILWRDVDWNFYRQGDQNVLYWHWSPEYGWAMDFPVHG
YNECLIMYLLAAASPTHGVPAAVYHDGWAQNGAIVDPHKVEGIELHLRYQGCEAGPLFWA
HYSFLGLDPTNLKDEYCSSYFDEMRNLTLVNRAYCIRNPKHYKGFGPDCWGLTASYSVNG
YAAHMPNERDDQGVISPTAALSSIVYTPEQSLAVMRHLYGMGDKLFGPYGFYDAFSETDN
WYPKRYLAIDQGPIAVMIENYRTGLLWNLFMSHPDIQNGLQKLGFSINRKAGSSTQ

Enzyme Prediction     

EC	3.2.1.71

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH144	774	1186	8.3e-189	0.9925742574257426
GH3	99	324	3.1e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	9	766	12	764	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.17e-112	43	356	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam10091	Glycoamylase	3.33e-111	955	1174	1	215	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.
COG1472	BglX	7.12e-104	42	449	1	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
COG5368	COG5368	2.54e-91	777	1185	10	430	Uncharacterized protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67944.1	0.0	1	1196	1	1196
ALJ59511.1	0.0	1	766	1	783
QUT89446.1	0.0	1	766	1	783
QUT33440.1	0.0	1	766	1	775
BBK86043.1	0.0	1	766	3	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	0.0	26	766	4	750	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	0.0	24	766	3	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	0.0	24	766	3	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
4QT9_A	4.07e-272	772	1190	16	434	Crystalstructure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution [Bacteroides caccae ATCC 43185],4QT9_B Crystal structure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution [Bacteroides caccae ATCC 43185]
3EU8_A	1.33e-259	769	1189	10	430	Crystalstructure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_B Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_C Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_D Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	3.67e-225	27	766	30	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.80e-222	27	766	30	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.08e-135	88	766	48	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A6LGF6	1.03e-124	767	1183	291	717	Exo beta-1,2-glucooligosaccharide sophorohydrolase (non-reducing end) OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_3064 PE=1 SV=1
T2KMH9	2.88e-112	35	766	40	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000522	0.998572	0.000374	0.000176	0.000183	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04510.