CAZyme Information: MGYG000002470_02357

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02357
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000002470_3|CGC20	36237.28	8.117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 856475; End: 857443 Strand: -

Full Sequence      

MKRLAYYLCGIVLLLVGIIPLSAQTQWKDTIVVSRDGSGDYRTLTEAMEGIRAFMDYKVT
VLVKNGTYKEKVVIPSWLQNVEFIGESVENTIITYDDHANINKMGTFRTYTVKVEGNSIT
FRNLTIENNAARLGQAVALHTEGDKLVFINCRILGNQDTIYTGAAGTRLYFADCYIDGTT
DFIFGPSTAFFENCEIRSKTNSYVTAASTPKDIAVGYVFKNCRLTADPGVDKVYLGRPWR
PYAATVFINCEMGKHIRPEGWHNWGNVENEKTARYAEYGSTGEGAPVADRVKWAKQLTKK
EAARYDDLSYIYKMCSDWKPAK

Enzyme Prediction     

No EC number prediction in MGYG000002470_02357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	311	3.1e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.15e-76	33	311	9	296	pectinesterase
pfam01095	Pectinesterase	2.16e-76	31	305	2	289	Pectinesterase.
COG4677	PemB	5.78e-68	19	305	74	396	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	2.48e-67	30	311	70	361	pectinesterase family protein
PLN02432	PLN02432	6.94e-64	31	303	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69178.1	3.90e-243	1	322	1	322
ALJ61263.1	1.19e-212	1	320	1	320
QUT93208.1	1.19e-212	1	320	1	320
QRQ48638.1	3.08e-181	1	319	1	320
QUT45769.1	7.63e-181	8	319	4	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.00e-43	32	293	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.24e-43	31	293	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.01e-34	39	318	17	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.37e-34	39	318	17	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.99e-30	32	320	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.24e-60	33	311	9	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	9.25e-53	28	311	257	553	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8GXA1	1.23e-52	28	305	255	545	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8GX86	1.41e-52	22	322	247	557	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q9FM79	8.39e-52	25	312	76	373	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002597	0.995637	0.001012	0.000235	0.000227	0.000252

TMHMM  Annotations     

start	end
5	27