CAZyme Information: MGYG000002468_00575

Basic Information

• Species: Enterococcus caccae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus caccae
• CAZyme ID: MGYG000002468_00575
• CAZy Family: GH73
• CAZyme Description: Muramidase-2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285		30438.71	4.4982

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002468	3531321	Isolate	United States	North America

• Gene Location: Start: 195010; End: 195867 Strand: +

Full Sequence      

MDEIRTRSSRHEQKMYKNNHKRMVSVIGTSLVFLPIVGNLLPLGVEATEAETQGAVSQQA
FIDSIGYSAASVADANDLYASVMIAQALLESSYGTSGLAAAPNYNLFGVKGSYGGQTVYM
PTAEYLNGEWVTVTEPFRSYPSYTESFQDHANVLRTTLASSGNYHYSGVWKSNTTSYMDA
TAALAGRYATDPNYASKLNWLISAYGLTAYDSGNTVASTTYESQSGDQATIGQSSATASG
QTYTVVSGDTLWGIAEKFGVSVDQLMASNGITAELITVGQVLQIV

Enzyme Prediction     

EC	3.2.1.-	3.2.1.17	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	69	207	1e-26	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	6.98e-71	59	284	151	374	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	2.57e-63	21	223	3	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.80e-50	57	227	319	488	amidase domain-containing protein.
smart00047	LYZ2	8.59e-39	57	210	7	144	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.77e-20	69	150	4	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS38046.1	4.17e-181	1	284	1	285
ALS00641.1	1.23e-154	1	284	1	283
ARV03607.1	8.48e-106	1	284	1	285
QKR88416.1	8.48e-106	1	284	1	285
QXN81410.1	1.20e-105	1	284	1	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.05e-43	58	211	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.41e-32	61	211	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.57e-17	59	207	2	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.59e-17	59	207	3	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.97e-16	59	207	3	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.29e-68	57	280	179	400	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.15e-68	21	284	22	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	2.12e-63	57	280	61	280	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.85e-63	57	280	61	282	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	7.95e-63	57	280	61	282	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.030229	0.968000	0.000591	0.000632	0.000280	0.000244

TMHMM  Annotations     

start	end
23	45