CAZyme Information: MGYG000002465_01107

Basic Information

• Species: Yersinia massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia massiliensis
• CAZyme ID: MGYG000002465_01107
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		43193.64	6.6396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002465	4872451	Isolate	Finland	Europe

• Gene Location: Start: 163556; End: 164740 Strand: +

Full Sequence      

MQISPLVADRPSSGERPLTIGLVAGETSGDILGAGLIRALKAQVPNARFVGVAGPLMQAE
GCEAWFEMEELAVMGVVEVLERLPRLLKIRKELTQRFSELAPDVFVGIDAPDFNITLEGR
LKQRGIRTIHYVSPSVWAWRQKRVFKIGKATDMVLAFLPFEKAFYDRFNVPCRFIGHTMA
DAMPLTPDKPAARAELGIAPNVPCLALLPGSRHSEVEMLSGDFLRTAVLLKQKLPELEVL
VPLVNSKRREQFERIKAEVAPDLSVHLLDGNARAAMIASDATLLASGTAALECMLAKCPM
VVGYRMKPFTFWLAERLVKTPYVSLPNLLAGEELVTELLQQECQPQALADALLPLLQGGE
AVEALKARFLILHQSIRCGADEQAAQAVMELAGR

Enzyme Prediction     

No EC number prediction in MGYG000002465_01107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	20	377	1.4e-138	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	19	391	7	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	17	394	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	17	394	1	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.86e-174	20	388	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	6.71e-49	22	339	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ11861.1	4.34e-281	1	394	1	394
AVX37055.1	4.34e-281	1	394	1	394
ATM87147.1	5.06e-280	1	394	1	394
AKP32870.1	7.93e-270	1	393	1	393
QKJ05729.1	4.76e-269	1	394	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.61e-210	15	392	4	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.32e-209	15	392	4	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZH55	5.74e-255	1	394	1	394	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	5.74e-255	1	394	1	394	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
Q7N8N4	1.59e-230	16	394	11	389	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
A8GID3	9.58e-228	16	392	4	380	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
C6DAJ6	1.74e-221	16	391	4	379	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002465_01107.