CAZyme Information: MGYG000002463_05710

Basic Information

• Species: Pseudomonas aeruginosa
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
• CAZyme ID: MGYG000002463_05710
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948		104794.8	8.6418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002463	6750396	Isolate	Brazil	South America

• Gene Location: Start: 89080; End: 91926 Strand: -

Full Sequence      

MRFSKKGIAVLRLPSRRNTLRPIERPLAWLAGLALALCAGAAAGAAGGPSSVAFWYAERP
PLAELSQFDWVVLEAAHLKPADVGYLKEQGSTPFAYLSVGEFDGDAAAIADSGLARGKSA
VRNQAWNSQVMDLAAPSWRAHLLKRAAELRKQGYAGLFLDTLDSFQLQAEERREGQRRAL
ASFLAQLHRQEPGLKLFFNRGFEVLPELPGVASAVAVESIHAGWDAAAGQYREVPQDDRD
WLKGHLDALRAQGMPIVAIDYLPPERRDEARALAARLRSEGYVPFVSTPALDYLGVSDVE
VQPRRIALLYDPREGDLTLSPGHVYLGGLLEYLGYRVDYLPADQPLPERPLSGLYAGVVT
WMTSGPPLASDAFDNWIAARLDEKVPVAFLAGLPTENDGLLQRLGIRRLSQKLKVKPSTE
THDQALLGAFEAPLVIRVRDLPALTVLDPARVAPALKLKGDGKEYVPVATADWGGFALAP
YVLEEGSEHRRWILDPFAFLRKALRLAPLPSPDATTENGRRIATVHIDGDGFVSRAEVPG
SPYAGQQVLEDFIKPYPFLTSVSVIEGEVGPKGMYPHLARELEPIARRIFADDKVEVASH
TFSHPFFWQPQLAEQGENFEAQYGYKMAIPGYDKVDFVREVIGARDYIEQRLTTPRKPVK
MIFWSGDALPDAATIKLAYDAGLMNVNGGNTALTRAFPSLTGLYPLIRPTRGGVQYYAPI
INENVYTNLWQGPYYGFRGVIDTFALTDSPRRLRGLHLYYHFYSGTKQASIRTMHQIYAA
MQAEHPLSLWMSDYIPRLEGLHRASLAKRADGSWQLRGFAALRTVRLDPALGWPDLARST
GVAGVRDLPQGRYVHLSAANARLVLRDSRDPRPALEEANLPLKHWRYRDDGRVEFAFAGL
LPLRLVVRAAGDCRLSAAGKAFPGKAGNGLWTFELPMEQVRDGQLVCR

Enzyme Prediction     

No EC number prediction in MGYG000002463_05710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	69	291	2.9e-70	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10922	CE4_PelA_like_C	9.24e-140	518	784	1	266	C-terminal Putative NodB-like catalytic domain of PelA-like uncharacterized hypothetical proteins found in bacteria. This family is represented by a protein PelA of unknown function that is encoded by a gene in the pelA-G gene cluster for pellicle production and biofilm formation in Pseudomonas aeruginosa. PelA and most of the family members contain a domain of unknown function, DUF297, in the N-terminus and a C-terminal domain that shows high sequence similarity to the catalytic domain of the six-stranded barrel rhizobial NodB-like proteins, which remove N-linked or O-linked acetyl groups from cell wall polysaccharides and belong to the larger carbohydrate esterase 4 (CE4) superfamily.
COG3868	COG3868	2.36e-101	51	359	26	306	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	3.37e-11	86	292	35	220	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	6.96e-11	66	310	42	299	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd10585	CE4_SF	4.78e-04	525	617	4	87	Catalytic NodB homology domain of the carbohydrate esterase 4 superfamily. The carbohydrate esterase 4 (CE4) superfamily mainly includes chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan, respectively. Members in this superfamily contain a NodB homology domain that adopts a deformed (beta/alpha)8 barrel fold, which encompasses a mononuclear metalloenzyme employing a conserved His-His-Asp zinc-binding triad, closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. The NodB homology domain of CE4 superfamily is remotely related to the 7-stranded beta/alpha barrel catalytic domain of the superfamily consisting of family 38 glycoside hydrolases (GH38), family 57 heat stable retaining glycoside hydrolases (GH57), lactam utilization protein LamB/YcsF family proteins, and YdjC-family proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AON18245.1	0.0	1	948	1	948
AON30241.1	0.0	1	948	1	948
AON12258.1	0.0	1	948	1	948
AON36245.1	0.0	1	948	1	948
AON42228.1	0.0	1	948	1	948

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TCB_A	1.45e-175	47	303	22	278	Structureof the glycoside hydrolase domain of PelA from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5TSY_A	1.15e-174	47	303	22	278	Structureof the glycoside hydrolase domain of PelA variant E218A from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.354811	0.607252	0.028636	0.005096	0.002362	0.001834

TMHMM  Annotations     

start	end
26	48