CAZyme Information: MGYG000002459_00146

Basic Information

• Species: Bifidobacterium animalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium animalis
• CAZyme ID: MGYG000002459_00146
• CAZy Family: GH1
• CAZyme Description: Bifunctional beta-D-glucosidase/beta-D-fucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000002459_1|CGC5	52143.2	4.5556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002459	1958651	Isolate	China	Asia

• Gene Location: Start: 172048; End: 173430 Strand: +

Full Sequence      

MTMTFPKGFQFGTATAAYQIEGAVDEDGRTPSIWDVFSHAPGRVLNGDTGDKADDFYHRW
QDDLKLVRDLGVNAYRFSIGVPRVIPTPDGKPNEKGLDFYERIVDQLLEYGIDPIVTLYH
WDLPQYLNEDPYRDGWLNRETAFRMAEYAGIVAKRLGDRVHTYTTLNEPWCSAHLSYGGT
EHAPGLGAGPLAFRAAHHLNLAHGLMCEAVRAEAGAKPDLSVTLNLQVNRGDADAVHRVD
LIANRVFLDPMLRGYYPDELFAITKGICDWDFVHDGDLKLINQPIDVLGLNYYSTNLLAM
SDRPQFPQSTEASTAPGASDIDWLPTDGPHTQMGWNIDPDALYNTLVRLNDDYDHIPLVV
TENGMACPDEVEVGPDGVKMVHDDDRIDYLRRHLEAVHRAIEEGANVIGYFVWSLMDNFE
WAFGYDRRFGLTYVDYDTEERIRKDSYNWYRNFIAEHSAK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.23	3.2.1.74	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	457	1.8e-156	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	0.0	6	450	1	426	beta-galactosidase.
pfam00232	Glyco_hydro_1	2.63e-174	1	457	1	451	Glycosyl hydrolase family 1.
COG2723	BglB	4.41e-163	2	456	1	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	1.88e-111	1	451	1	460	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	2.77e-78	5	454	28	480	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL28444.1	0.0	1	460	1	460
AFS33105.1	0.0	1	460	1	460
AFJ15907.1	0.0	1	460	1	460
ADC85172.2	0.0	1	460	1	460
AJD87925.1	0.0	1	460	1	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GNX_A	1.08e-167	3	450	16	467	b-glucosidasefrom Streptomyces sp [Streptomyces sp.],1GNX_B b-glucosidase from Streptomyces sp [Streptomyces sp.],1GON_A b-glucosidase from Streptomyces sp [Streptomyces sp.],1GON_B b-glucosidase from Streptomyces sp [Streptomyces sp.]
7BBS_A	1.38e-156	5	450	20	474	ChainA, Beta-glucosidase Bg10 [uncultured bacterium],7BBS_B Chain B, Beta-glucosidase Bg10 [uncultured bacterium]
6Z1H_A	5.16e-143	2	460	8	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6ZIV_AAA	3.62e-137	5	454	15	450	ChainAAA, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_BBB Chain BBB, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_CCC Chain CCC, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_DDD Chain DDD, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_EEE Chain EEE, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_FFF Chain FFF, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_GGG Chain GGG, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_HHH Chain HHH, Beta-glucosidase [Alicyclobacillus tengchongensis]
1UG6_A	4.19e-135	9	455	8	427	Structureof beta-glucosidase at atomic resolution from thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94248	1.24e-303	1	460	1	460	Bifunctional beta-D-glucosidase/beta-D-fucosidase OS=Bifidobacterium breve OX=1685 PE=1 SV=1
P38645	9.80e-128	3	460	36	470	Thermostable beta-glucosidase B OS=Thermobispora bispora OX=2006 GN=bglB PE=1 SV=1
P22505	6.67e-122	2	456	5	445	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
Q03506	2.85e-121	5	455	6	444	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P10482	3.79e-120	1	458	1	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002459_00146.